SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTNIP00000020007 from Tetraodon nigroviridis 76_8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTNIP00000020007
Domain Number 1 Region: 389-655
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 8.5e-78
Family Protein kinases, catalytic subunit 0.0000257
Further Details:      
 
Domain Number 2 Region: 227-342
Classification Level Classification E-value
Superfamily PH domain-like 1.55e-33
Family Pleckstrin-homology domain (PH domain) 0.0000273
Further Details:      
 
Domain Number 3 Region: 87-149
Classification Level Classification E-value
Superfamily Cysteine-rich domain 6.58e-18
Family Protein kinase cysteine-rich domain (cys2, phorbol-binding domain) 0.0017
Further Details:      
 
Domain Number 4 Region: 1-32
Classification Level Classification E-value
Superfamily Cysteine-rich domain 0.0000000171
Family Protein kinase cysteine-rich domain (cys2, phorbol-binding domain) 0.0033
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTNIP00000020007   Gene: ENSTNIG00000016889   Transcript: ENSTNIT00000020238
Sequence length 682
Comment pep:known_by_projection chromosome:TETRAODON8:10:3190470:3199160:1 gene:ENSTNIG00000016889 transcript:ENSTNIT00000020238 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLWGLVRQGLKCEGCGLNYHKRCAFKIPNNCSGVRKRRLSNVSLPGPSLSVPRPASTENA
VLLLDEQRTHQEAGKRILSWSGRPIWMEKMVLGRVKVPHTFAIHTYTRPTICQYCKRLLK
GLFRQGMQCKDCRFNCHKRCASKVPRDCLGEVDFNGGFAHVEPASPGPDSDSTMDTMEVD
SSDLDGSRGLDDPEEPSTPGSPSTSSNIPLMRVVQSIKHTKRRSSTVVKEGWMVHYTSRD
NLRKRHYWRLDSKSLSLFQNDTGAKFYKEIPLSEILQVEQSGDYSNLAQGSNPHCFEIIT
STMVYYVGENNCSPYHNPALAASGVGMEVAQGWEKAIRQALMPVTPQPSVASAAGQGRDH
KELSISISVSNCQIQENVDIASVYQIFSDEVLGSGQFGIVYGGKHRKSGRDVAIKVIDKM
RFPTKQESQLRNEVAILQNLHHPGIVNLECMFETPERVFVVMEKLHGDMLEMILSSEKSK
LPERITKFLVTQQILVALRHLHFKNIVHCDLKPENVLLASAEPFPQVKLCDFGFARIIGE
KSFRRSVVGTPAYLAPEVLRSKGYNRSLDMWSVGVIVYVSLSGTFPFNEDEDINDQIQNA
AFMYPPNPWKDISAEATDLINNLLQVKMRKRYSVDKCLSHPWLQDYQTWLDLREFETRRG
ERYITHESDDARWEEYADEHCL
Download sequence
Identical sequences H3DHL3
ENSTNIP00000020007 ENSTNIP00000020007 99883.ENSTNIP00000020007

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]