SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTNIP00000020038 from Tetraodon nigroviridis 76_8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTNIP00000020038
Domain Number 1 Region: 762-992
Classification Level Classification E-value
Superfamily vWA-like 3.86e-53
Family Integrin A (or I) domain 0.00017
Further Details:      
 
Domain Number 2 Region: 46-234
Classification Level Classification E-value
Superfamily vWA-like 7.12e-35
Family Integrin A (or I) domain 0.0012
Further Details:      
 
Domain Number 3 Region: 1075-1130
Classification Level Classification E-value
Superfamily BPTI-like 2.41e-19
Family Small Kunitz-type inhibitors & BPTI-like toxins 0.00096
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTNIP00000020038   Gene: ENSTNIG00000016919   Transcript: ENSTNIT00000020269
Sequence length 1132
Comment pep:known_by_projection chromosome:TETRAODON8:2:13943540:13953830:-1 gene:ENSTNIG00000016919 transcript:ENSTNIT00000020269 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
VWMRMFSSTLVLLLSALTSVWTQTPLEEKNPVTTVLTTGTHGKQEECGLELSFLLDSSES
AKDNHEQEKEFAMKVVDRLEGTRLRSGRSLSLRVALLQYSSHVITEQTFKDWRGTENFKA
RITPIVYIGHGTYTTYAITNMTKIYLEESSPGSIRVAVLLTDGVSHPRNPDISSAVADAN
NQGIRFFTLGITRAAKEPTNIAQLRLIASSPASRFLHNLQDEDIVEKIVTEITTLANQGC
PLAQKCACEKGERGLSGPAGKRGRPGEDGAPGVKGEKGEHGPGGLPGQEGPEGKPGYKGE
KGGRGECGTPGTKGDMGPVGLVGTRGPRGLQGVPGPPGDIGPEGIQGKQGERGPTGPPGI
QGETGKGLPGPKGDIGFQGQPGPPGPPGIGEQGPPGPQGPQGVQGSKGPPGEGLPGLKGD
QGLPGPRGPRGQQGVGIKGEKGDLGPPGFPGPTGPIGVGLQGEKGVEGPRGPPGVRGIPG
EGLPGPKGDQGLPGEQGVPGDRGVGEAGPKGEPGAAGIGGLPGLPGEDGAPGQKGEPGLP
GLRGLEGAQGIGTQGEKGDQGQRGIRGLHGPPGIPGPSGPKGERGLPGQQGVPGQPGRSV
PGPKGDVGSLGPPGPIGETGHGLPGPKGDRGHPGLPGPYGPKGEGLPGPMGPTGLPGLPG
EPGPEGLGIPGPKGDIGFRGLPGLPGPPGAGIQGPPGNIGRPGPPGPRGPQGDGIQGPKG
EPGSQGMTGPRGPAGDGFPGAKGDRGFTGEKGVKGSKGDLGDSGLPGEAGTPGAKGEAGL
TREDIIKLIKEICGCGIKCKERPMELVFVIDSSESVGPENFEIIKDFVIRLVDRTTVGRN
ATRIGLVLYSLEVRLEFNLARYVTKQDIRQAIRKIPYMGEGTYTGTAIRKATQEAFLNAR
RGVSKVAIVITDGQTDKREPVKLDLAVREAHAANIEMYALGIVNASDPTQAEFLQELNLI
ASDPDSEHMYLIDDFNTLTALESKLVSQFCEDENGALIYNHVTNGHRSINNGHGVLINKT
SVEPVRESSMANDVVSNVSSSSTATLSSDSSESKQLHSTTLPGKWRFSSPEETPIDPRCT
LSLDQGSCRNYSIHWYYDQQANSCAQFWYGGCGGNENRYGTEDECRRTCVVR
Download sequence
Identical sequences H3DHP4
99883.ENSTNIP00000020038 ENSTNIP00000020038 ENSTNIP00000020038

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]