SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTNIP00000020108 from Tetraodon nigroviridis 76_8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTNIP00000020108
Domain Number 1 Region: 733-931
Classification Level Classification E-value
Superfamily vWA-like 9.06e-54
Family Integrin A (or I) domain 0.0004
Further Details:      
 
Domain Number 2 Region: 556-725
Classification Level Classification E-value
Superfamily vWA-like 9.94e-45
Family Integrin A (or I) domain 0.00034
Further Details:      
 
Domain Number 3 Region: 974-1001
Classification Level Classification E-value
Superfamily Chicken cartilage matrix protein 0.0000000111
Family Chicken cartilage matrix protein 0.0019
Further Details:      
 
Domain Number 4 Region: 199-241
Classification Level Classification E-value
Superfamily Homeodomain-like 0.00000642
Family Homeodomain 0.0078
Further Details:      
 
Domain Number 5 Region: 1119-1194
Classification Level Classification E-value
Superfamily AhpD-like 0.0000302
Family Atu0492-like 0.039
Further Details:      
 
Weak hits

Sequence:  ENSTNIP00000020108
Domain Number - Region: 937-975
Classification Level Classification E-value
Superfamily vWA-like 0.0119
Family Integrin A (or I) domain 0.0095
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTNIP00000020108   Gene: ENSTNIG00000016985   Transcript: ENSTNIT00000020339
Sequence length 1448
Comment pep:known_by_projection chromosome:TETRAODON8:21:1145991:1163921:-1 gene:ENSTNIG00000016985 transcript:ENSTNIT00000020339 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEESCDFSQEFEEEEVRLDTSQGGEDEQVDGRTEANQEQSSRSQTQEVSAVSSEDGSALS
EPPAAPMNSCDLSDPAYLGLYCPPLPTLYSAQPPAPMQPAPPQAQGSRRPPSTLLAHSLP
PPGPQPLEMEITQVYSTRRSIRYRSRGRGQALNLSLLPGLEAMDSCLQPPALKKKTRTLY
STGNCTVVTGSGFILGPPARACAHADQLEHLEALFQEDHYPDAEKRKVIAASVGVTPQRI
MVGPPSQKRATGNDLFTGGNRVPVMCRRASRVQVSLPPWLNAPVCVVEFSLCHRSAPVKG
RDGGPQPLSAQGALTEYQPRPMHSPPPLRRASLPLFQTGYNPANPPPPPLHNTLAHTPPL
FPDASEGGSALAQRDALQPLQTDTSSLFDFVEKFEYLTSSQQNSSLQYQFQAAYPSGQPQ
PRMAYLTPSPYLTPNAPDSNPASYLTFGPGGSSAGLMTYSAGGHAYFQSQNTGQILLQSA
GHHGGMAAYQSYPWGSLYSQPAMQQRAPCPPAMGGAREHQPLTSTLPPLSFFTLRACVRR
VPRTSSSSLTAAAASDPSEFEQVKVFLAKVIEGLDVGPNATRVGVVNYASRVKNEVSLKT
HRTKAGLIKAVTKIEPLSTGTMTGLAIQFAMNVAFSEAEGARLRSPDISKVAIVVTDGRP
QDNVKDVAQRARDAGIEIFAIGVGRVEMSTLRQMASDPLDDHVDYVESYSVIEKLTKKFQ
EAFCGAHTVSDLCATGDHDCEQVCISSPGSYKCACKEGFTLTDDGRSCRACSNAATDVVF
LIDGSKSVRPENFELVKKWINQIIDKLDVSDNKAHVGLVQYSSAVKQEFPLGRYNNKKDL
KEAVKKMAYMERGTMTGQALRYLTDNSVTKVGIVFTDGRSQDYIGDAAKKAKDQGFKMYA
VGVGNAVEDELKEIASEPTAEHYFYTADFKTDGQRREDELKEIASEPTAEHYFYTADFKT
MTQIAKKLQINICQDEDPCECDSLVKFQKKVEEAIQALTKRTRHPGSASSGVGAQRLHPR
GRDAEGRAGSGHLHRLLSFAGSCGPPDHGDGAAPVLPQLLPEGPACPAGAGRAPAPPLEA
LHSPDGGGSAPVPVPGAAAQRRFPGGGGEESWLSGLEQTPGKLRSLQTLNKLLAHRPWLI
TQQHIQELVFPGADPRWSLAELIHAVILMAHAHSLCSFVWGCGLNPEPDHSGGYTFQPPS
PGHLPHSPAHEDGRQEMVDGAMEVEVLMKRMVELQQQQEEEECTQEEMVTRFERQRSESI
PTALVRPAPPDTVLRLVEDPEFRYEDFAPRGEQAPPTMRAQYNRLLPDMGQFLDEKFQVV
SNLTYHRMAMHEGVDTHTLRKALWNYIHCLYGIRWVPRTPELRRLRLRQRQRAAGALPEG
VCQNHGLPPRADHRPHLPRLLEALQTLGKGSRQSDRDGSSATGSPSLYLTSHYSLHEMTS
SAPFVCSC
Download sequence
Identical sequences H3DHW4
99883.ENSTNIP00000020108 ENSTNIP00000020108 ENSTNIP00000020108

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]