SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTNIP00000020150 from Tetraodon nigroviridis 76_8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTNIP00000020150
Domain Number 1 Region: 232-410
Classification Level Classification E-value
Superfamily MIR domain 8.63e-46
Family MIR domain 0.0032
Further Details:      
 
Domain Number 2 Region: 1069-1188
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 1.37e-16
Family SPRY domain 0.046
Further Details:      
 
Domain Number 3 Region: 671-809
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 0.00000000000641
Family Galectin (animal S-lectin) 0.078
Further Details:      
 
Domain Number 4 Region: 4024-4086
Classification Level Classification E-value
Superfamily EF-hand 0.0000000532
Family Calmodulin-like 0.039
Further Details:      
 
Domain Number 5 Region: 2164-2210,2519-2588,2658-2683,2979-3014,3049-3192,3286-3415
Classification Level Classification E-value
Superfamily ARM repeat 0.000000403
Family MIF4G domain-like 0.077
Further Details:      
 
Domain Number 6 Region: 1410-1550
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 0.0000095
Family SPRY domain 0.043
Further Details:      
 
Domain Number 7 Region: 453-566
Classification Level Classification E-value
Superfamily IP3 receptor type 1 binding core, domain 2 0.0000144
Family IP3 receptor type 1 binding core, domain 2 0.022
Further Details:      
 
Weak hits

Sequence:  ENSTNIP00000020150
Domain Number - Region: 107-188
Classification Level Classification E-value
Superfamily MIR domain 0.00314
Family MIR domain 0.033
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTNIP00000020150   Gene: ENSTNIG00000017023   Transcript: ENSTNIT00000020381
Sequence length 4931
Comment pep:known_by_projection chromosome:TETRAODON8:17:11739157:11777467:1 gene:ENSTNIG00000017023 transcript:ENSTNIT00000020381 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSDFGEGDEEFQFLRTGDEVVLQSIFTLRGEHVKICLAAEGFGTRLCRLEPIFNCKNVPP
DVSVCGFVLAHCLSVRALQEMLTHTEHLAAEILHLQLAAGGGHRTLLYGQAVLFLHSYSS
MYLSCLSSSQSATDKLAFDVGLQEDKEGETCWWIVHPSSRQRSEGEKVRVGDDLILVSMS
SERYLHLSVGSGSDSSSSLSDSLSVSASFQPTLWSVAPIYSGGGVAQGYLKGGDTFRLHH
SHSDACLTIASADQGEEPQKVMHYESGAVSSHARSLWRLEILHVVWSGSHTCWGQPFRLC
HMTTGRYMGLTEERGLHLVERDKADVRMSSFCFRSSKEKLDPGTRTNADGMGSPEIKYGD
SVCYVQHVDSGLWLTYRPVDAKSSRLRSTQRKAILHSEGHMDDGLRLSRCQREESHTARL
IRSASFLFTNFIRKQDSCSQHGNQVSVCSPGEMMKRSLQDLISYFYPTPETVEHEAKCHN
MVVLKNRQNMFQEEGVIDLVLVCIDHLHQHIGTSQCAEAAQEDSEEEWESCLDGFYKLLA
ALLRGNRANCARFSASIDWLISKLDWLEAATGVLEVLQCVLLESPEALNVVKENHIHSVI
SFLDKHGLNHKVLEVLCALCVCHGVAVRYNQNLICDKLLPERDLLLQTRLVNRVTSMRPN
IFLAFSEDSAQHRRWYYEVVVDHLDSFLTSEPTHLRVGWACTEGYRPRLSGGEGWGGNGV
GDDLCSYGFDGLHLWAGGVGRSVSSPFSHSLKDGDVVSCCLDLSAPCISFRVNGLPVQGM
LENFVAEGLLYPVVSFSAGVRIRFLFGGQHGEFRYLPPPGFTACSDALLPKVKLKVEPCQ
KYILNREEGKHDLIGPWIPTAPVVFIPAPVDISKVSLPPQLEDIQEKLAENIHELWAMDK
IDLGWTYGPVRDEAKKNDPSLAEFSKLSEHERNQNLHVAQDTLRTLLAFGFCIGFNEGHS
NDRVRNKRLAAKYEQPGGYRPAPVDLSQVLLSSEHQEVVNLLAENDHNVWARERIAQGWT
YGTQQDVKAKRSPYLVPYSFLDEKTRRLSRDSVREVVGTLLAFGYSLDPHSLKQATLANQ
CLFSAEKCRVFRPDKSHAVSRGKWYFEFEAVTAGKMRVGWARPSCSPSRELGSDDRAFVF
DGFEAQWYHQGAEPLGRSWQRGDVVGCLVDMDESTMMITLNGELLFDARGSELAAKDFDI
SDGLLPVASLGVNQVGRLNLGRCAASLQYFTVCGQQEGYQPFAVNMARDPALWISWQQPQ
FSSIRPDDHIQVGVTRASGSVGSLSSLRVSQRLFAHYNGSSQISFFRLSMHIECASVLIS
PAGGVLPVASSSLSPGRREQEEVDPDFEVLRKSALTFAGSRDELNHKDHNQEKTTRMKHR
FLLKRNKPGLVSSNSSARLLEDVVFDKENCDHLIQSSRYYYSARVLPGQEPFNVWVGWVT
SNFHSHDATFDPDGVHTVTVTLGDDSGKVQESIKRRVCYMVCAGEATGLAQSRRSSGLEI
GCLIDTATGLLTFTSNGVEMSTFFQVEACTKLFPAVFVRPTTTCMFQFEFGCIKNAMPLS
AGLLRSQRCNVTPHCPPRIQVQQLKPGSWTRLPSQAVKVVVDQPDAYGGWTIQCSEALQV
MNLQIPDENRCVDILELSELDDLLTFHLHTLRLYCSLCSLGNTRVSHAICSYLDTSQFLH
AIQNPHLPGLLRSVFYQLLIQVHLSSHTTACLMMNHEYIIPMAAKAGDTTLYPSSFTGHN
GGNGITNSSHCTSLKPQMHFSSPSFVSNYALEGNYTAERNHGDSPEFPLDLLKNLTIQML
TEAVTALCQEVRDPVGGTIELLLVPLIKLAYSLLVMGVLEDEDLGKVLRLLDSEVSFTNS
QSSMDEEKEDEKDDEKEHSLHHHQKDSHPKIGLLQIKLPEAVKLELCHLLSYLCDCQMRQ
RVEAVAAFSDTFVCQLQENQRFRYNEVMQALNMSAALTARKTKEFRSPPREQINMLLSFR
DDEVSCPCPVQIQELLHNFHHLFKTHCGIESESDGEDEEAAESVRTQILSQVAKVIGIKK
KPLEVDASKPVASTLETLKHLVSKTLVHWSQEKMQDPELVRAVFSLLHCQYQGLGGQMAG
PLSRTYTISHTSVDDTMALLSSLSQIRSLLCVRMGKEEEKLMIRKLGDIINNKVFYQHPD
LMRTLGMHETVMEVMVNVLGEGESKEIAFPKMVASCCRFLCYFCRISQHNQGALFDHLSY
LLENASVGLASPSMRGATPLDVAAASVMDNNELALALTESNLQKVIHYLASCGLKSCPML
VAKGYPDIGWNPVEGERYLDFLRFAVFCNGESVEENAYMVLRLLIRRPECFGPALQGDGG
NGLLAAVREAIRISDDPSMDGPSGPHQSTRSMFIPVYQDNDDDLIHMGHAMVTFYSALID
LLGRCAPEMHLIEGGKGEALRVRAILRSLVPVHDLEGVISSSFCLPSVTKDGGVVEPDLS
AVFCPDHKAAMVLFLDRVYGIQNQSFFLHLIEVGFLPDLQAAVSLDTVDLASTDMALALN
RYLCASVLPLLSKCSALFCDLEDHVLLVDSLIQAIYSLSHALSLTKAQRDTIEDCLLALC
SKLQPSLMQPLLRRLVFDVPHLPEHNKLALKLLTSHYEQRWKYYSMVGEPGDHSLASEEE
LHLSRKLFWSVFKDLNKKPYEPQLFRLCVQCLAAVAKALPPDHTDAGCTSAMEGKASADE
QFDPQPIDTSNVSVPERLEFIVNKYAEHTHEKWSLDKFANGWVHGEQLCESSKVHPLLKP
YRTLAEKEKEAYRCAIKETIKTMLAFGWSIERTKEADAHSVHTCARRVSQSGQQSFEGTS
TFSPKPTDVSTITLSWDQCAMAEQLAENYHSTWAKRKKLELQGRGGGGHSMVVPYDALTA
REKTKFRERAQDVLKFLHLNGYTVWRDRRTVEMDFPAVANCFGSTLLMQFLSHTENTQEH
MLEMEVMQARGQTSKGERTQLRQPVQVFHKVILPLLEEYVRTHCLYFLSSMSLSGKRGHA
SNKEKEMIASLFCKLAALIRHRMSLFGNEASAVSNCLCTLAQALDARTLMNSASESVRSS
LDSFFESSAADLEMTVENLCVSVARLSQSRSQHARGVARVLSYTSVVLLPTLTSLFQHLG
LQNYGGDLLVGTIQVSCYKILNSLYSLGTTSSIYMEGQRPAAGACLAALAATFPVCFLEP
DLNQNNPYSIYNTASALEKEELGLPDHAGDMCPLLPSLEQALGDVKQLAAAGAGARQSQY
IHVTEVVLPMLCSYMSLWWSWGPEGQPNSPLCTTVTPQHASDLLGHVLRIIHNHVGTSQA
DWMKRMAVHCLSITCHAHPELLKTHFLPLMEKLKKRAEGVLLEEERMKADAGDSSEAELE
IQQKFMVLVADLYAFYPLLIPFVDSNRARWLKESTPEAEQLFIMVAEVFTFWAKSHNFKW
EEQNYVVQNEINSLLFLVKSNKLSKFFNFQLNHEKRKVKKKGDRYSTHTSLVVASLKRLL
PVGLRNCLLSDRSLITLAKNGFTQKDTEDEIRQHIFSAFTLLQTQDHSFLNDEVNDAERG
GQRGKTADVQKAVDRVLNMGRVLCYLDQVEHPQRNRKTARHKILSKQRKRAVVACLRMAP
LYNLPRHRAVNLFLQGYNKTWISTEDHSFEEKLVEDLALSAKVSGGVAENDTVDGIKAID
PLLQLITLFSQTALMESSKLENGRLYQSYAAIMAKSCQRDDDGDGKEQELESFEEKELEK
QKLLFRQARLHRRGASEMVLQIISASRGLMGSVIAPTLKLGIALLSGGNAAVQQKMLVYL
RERRDVGFFQSMAGLMLSCSVLDLSAFERQNKAEGLGMAMDESSADKVMPDKDVTCDLFR
FLQLLCEGHNSEFQNYLRTQAGNNTTVNIVISTVDYLLRLQESVSDFFWYYSGKAAIDVH
GQHNFSKAIEVSKQVFNTLTEYIQGPCAGNQESLAHSRLWDAVIGFLHVFAHMQMKLPQD
SRQIDLLKELLDLQKDMVVFLLSMLEGNIVNGTIGKQMVDMLVESSGNVQMILRFFDMFL
KLKDFTSSDAFQAYDPDFKGCVSRKDFQKAMEGCKRFSQAETHFLMSCMGPDDREKVDYE
AFVDGFHEPAQDIGFSIAVLLTNLSEHMPNDSRLRTFLEVAESVLTYFQPFLGRIEILGS
GKRIERVYFGISASSRTQWEKPQVKESKRQFVFDVVNESGDKEKMEMFVNFCEDTIFEMQ
LAAQLSGSGVEERHVEASPEEKGDTNGLDNKGIGVMCQWLVLTSVLSVKALMKMSVKDVL
VSAVVFLKFVLMAQFRCVLIVVRSIWYVLHRAFLSGELIEGAKRARISEMLGGILEPTLD
EVMGGPRGTRLRKGSSSLTLQKELSGSRLAQTMASTRDMHVLSDIFGLTVKKEGSGYRLI
SKDLTDSLTDLFTPEPQTHIHQEEKTEEKGADGKQNKSDQNSEAILKDPKWRAQRLNPKS
KEAENQPSALWEMVSTHNKSMLNYFARNFYNLRVLALFVAFAINFILLFYKVASSPAAQV
EEKEMPSAYSAGDDAEEGTVCFVLEERSGYMEPSLRFLAVAHTIISFFCIFGYYCLKVPL
VIFKREKEVARKLEFDGLYVTKQPPEEDIKGQWDRLVVNTPSFPSNYWDKFVKRKVMDKY
GEFYGCEKISDLLGLDQAALDCSSERKGRKRLRRSTVWSHLFSSIDVKYQVWKTGVVFTD
NSFLYLAWYMAMSVLGHYNNFFFAAHLLDVAMGFKTLRTILSSVTHNGKQLVLTVGLLAV
VVYLYTVLAFNFFRKFYNKSEDKDARDMKCNDMLTCYMFHMYVGVRAGGGIGDEIEDPAG
DEFEVERIVFDITFFFFVIVILLAIIQGLIIDAFGELRDQQEQVKEDMETKCFICGIGSE
YFDKVPHGFETHTLQEHNLANYLFFLMYLINKDETEYTGQESYVWKMYQERSWEFFPVGD
CFRKQYEGQLG
Download sequence
Identical sequences H3DI06
ENSTNIP00000020150

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]