SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTNIP00000020210 from Tetraodon nigroviridis 76_8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTNIP00000020210
Domain Number 1 Region: 296-500
Classification Level Classification E-value
Superfamily Nucleotidyltransferase 1.7e-57
Family DNA polymerase beta-like 0.000000863
Further Details:      
 
Domain Number 2 Region: 142-232
Classification Level Classification E-value
Superfamily DNA polymerase beta, N-terminal domain-like 2.62e-28
Family DNA polymerase beta, N-terminal domain-like 0.0000699
Further Details:      
 
Domain Number 3 Region: 235-292
Classification Level Classification E-value
Superfamily PsbU/PolX domain-like 1.96e-17
Family DNA polymerase beta-like, second domain 0.00025
Further Details:      
 
Domain Number 4 Region: 35-124
Classification Level Classification E-value
Superfamily BRCT domain 0.00000000000291
Family DNA topoisomerase II binding protein 1, TopBP1 0.071
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTNIP00000020210   Gene: ENSTNIG00000017078   Transcript: ENSTNIT00000020441
Sequence length 501
Comment pep:known_by_projection chromosome:TETRAODON8:Un_random:94420739:94473099:1 gene:ENSTNIG00000017078 transcript:ENSTNIT00000020441 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MFHTPILPRTRKRSRAEQEVARPGREEVKFVNVRLYLVEMKMGHSRRSFLTQLARSKGFM
VEDDLSDSVTHVVSENSQASVLWAWLKDSGPANLPSMHVVNITWFTDSMKERRPVAVETR
HLIQDTLPMLPEGRKVVAVATVSQYACQRRTTTTNHNAVFTDAFEVLAECYEFNQMEGRC
LAFRRAASVLKSLPRVLSSLEDTHHLPCLGDHAKAIIDELLQHGRAFDVQKVLSDERYQT
LKLFTSVFGVGPKTAEKWYRTGLRAFEHILADRSIHLNHMQQNGFLHYEDISRAVSKAEA
RALTKVIDEVVHAITPDAIVALTGGFRRGKEFGHDVDIIFTTLEVGKEENLLLDVIKSLE
NQGVLLYCDYQAATFDTAKLPAHSFEAMDHFAKCFLILRLEASQVEGGLNSGEEDSRGWR
AVRVDLVSPPMNRYAFALLGWTGSRQFERDMRRFARKERRMLLDNHGLFDKNKKEFLAAT
TEKDIFDHLGLEYMEPWQRNA
Download sequence
Identical sequences H3DI66
ENSTNIP00000020210 99883.ENSTNIP00000020210 ENSTNIP00000020211

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]