SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTNIP00000020216 from Tetraodon nigroviridis 76_8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTNIP00000020216
Domain Number 1 Region: 1-130
Classification Level Classification E-value
Superfamily L domain-like 5.44e-32
Family Ngr ectodomain-like 0.0047
Further Details:      
 
Domain Number 2 Region: 222-344
Classification Level Classification E-value
Superfamily Hormone receptor domain 0.00000000000000929
Family Hormone receptor domain 0.0035
Further Details:      
 
Domain Number 3 Region: 155-256
Classification Level Classification E-value
Superfamily Immunoglobulin 0.0000000542
Family I set domains 0.049
Further Details:      
 
Weak hits

Sequence:  ENSTNIP00000020216
Domain Number - Region: 681-875,927-999
Classification Level Classification E-value
Superfamily Family A G protein-coupled receptor-like 0.00476
Family Rhodopsin-like 0.036
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTNIP00000020216   Gene: ENSTNIG00000017082   Transcript: ENSTNIT00000020447
Sequence length 1261
Comment pep:known_by_projection chromosome:TETRAODON8:Un_random:94601798:94719264:-1 gene:ENSTNIG00000017082 transcript:ENSTNIT00000020447 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LSNNKISLLRNGSFYGLAALEKLDLKNNLISTVEPGAFRGLLALRRLDLSNNRIGCLHPD
MFVDLGNLLKLNLSGNIFSTLSVGLFAHLVALRVLHFSTDALFCDCQLRWLLLWARSNAV
KIGNDTACMFPAHLHGFELRNLREHQLSCDGPLELPLFQLIPTQRQLVFRGDRLPLQCTA
SYLQSVALQWLHDGHVVTTMEDRGVYLEETLLHDCCLLTREVILSNIDVGISGIWECVVT
SSRGNVSQQMEIVVLETSATYCPADRVTNNKGDFRWTKTSAGALAFLPCAPATFASAVRP
TASTPRPSILKVKKAWRRCDHAGRWAEDDYTQCPYASELTRVLHELTQITLNTTNAQPFG
KQLVAFTSKAAHFTDVMDVIFVTHLVERLTRLVEKHKDLCGYISDIASNMMLVEEHILWM
AQNEARACTRIVQCVERIADLALAGDNKAISKVSANIALEAFLIRPSNFLGLSCTVLQQS
TSSAVSPITDREVGSKSDSGMDSLLNFKCHTVNTSGSPASLLSKNSVAVASIHLPLAGPP
LSSPALQSVDNSTCRLQFIVFRNGKLFPCTGNSSNLADDGKRRSVSTPVAFTKLDGCSLG
SVVHSVTIALRHFALGVDPTAAYWDFDLLDGHGGWRAEGCHITGSGGNTTTIHCTHHNNF
AVLMTLSGAECYKQTYPAEFLHPVVYACTAVMLLCLFASIITYIVHHSAIRISRKGWHML
LNFCFHTALTFAVFAGGINRIKYPTICQAVGIVLHYSSLSTMLWLGVTARNIYKQVTKKP
PQNQDRDPPPPPKQPLLKFYLVSGGVPLIICGVTAAVNIENYGSGEQAPYCWMAWEPSLG
AFFGPVAFIVLITCIYFLCTFIQLRKHPEKKYELKRLTEEQQRLAAVDVPTHCHQGAEPG
APASGGHCPAGCPGVPINPALLANEHSFKAQLRTAAFTLFLFLATWTFGALAVSQGHFLD
MIFSCLYGAFSVTLGLFVLIHHCAKRDDVWHCWCSSCPGRRANGCSGAHGPAQARPKVNV
NGNTPGHGHSHCHHDSPCPGKAALTCAHGGLATCKHAALPSSQNHVACLAPVTPCCAALH
SQQLMEEESAAATHVLLHADPEGYRPGIQLHPCLKSSTRTKSRQLSRRAGAGSEREYAYH
IPSSVDGGSVHSSHTDSPHSTHERHAHICPHLAPEGHHDGHHTCTHEALACHNHCHRHIC
CTKADLFPSLCPAEGADTQSYPQNPPNQNGILKGGLNEGLLYASDSTGNIRTGPWKNETT
V
Download sequence
Identical sequences H3DI72
ENSTNIP00000020216

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]