SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTNIP00000020233 from Tetraodon nigroviridis 76_8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTNIP00000020233
Domain Number 1 Region: 309-426
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.00000000000000628
Family Growth factor receptor domain 0.014
Further Details:      
 
Domain Number 2 Region: 901-1026
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.000000000000235
Family Growth factor receptor domain 0.016
Further Details:      
 
Domain Number 3 Region: 1152-1269
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.000000000000722
Family Growth factor receptor domain 0.014
Further Details:      
 
Domain Number 4 Region: 61-193
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.00000000000118
Family Growth factor receptor domain 0.013
Further Details:      
 
Domain Number 5 Region: 588-711
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.00000000000392
Family Growth factor receptor domain 0.018
Further Details:      
 
Domain Number 6 Region: 182-309
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.00000000000565
Family Growth factor receptor domain 0.012
Further Details:      
 
Domain Number 7 Region: 473-599
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.00000000000832
Family Growth factor receptor domain 0.02
Further Details:      
 
Domain Number 8 Region: 711-837
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.0000000000643
Family Growth factor receptor domain 0.016
Further Details:      
 
Domain Number 9 Region: 1021-1143
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.0000000000675
Family Growth factor receptor domain 0.016
Further Details:      
 
Domain Number 10 Region: 17-72
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000331
Family EGF-type module 0.014
Further Details:      
 
Domain Number 11 Region: 435-490
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000634
Family EGF-type module 0.028
Further Details:      
 
Domain Number 12 Region: 860-911
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000257
Family EGF-type module 0.0095
Further Details:      
 
Domain Number 13 Region: 1314-1345
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000317
Family EGF-type module 0.011
Further Details:      
 
Domain Number 14 Region: 1269-1302
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000726
Family EGF-type module 0.016
Further Details:      
 
Weak hits

Sequence:  ENSTNIP00000020233
Domain Number - Region: 829-854
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00545
Family EGF-like domain of nidogen-1 0.06
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTNIP00000020233   Gene: ENSTNIG00000017099   Transcript: ENSTNIT00000020464
Sequence length 1348
Comment pep:novel chromosome:TETRAODON8:Un_random:95303373:95307878:-1 gene:ENSTNIG00000017099 transcript:ENSTNIT00000020464 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
NFTCACRMGYQGDGLLCSDIDECLSGLHSCHPKARCNNTLGSYRCFCLSGYIGDGTQCQD
INECQEDNGGCHANALCTNYEGGRGCTCKDGFTGDGFQCSDVNECKNQKICHWNATCTNN
PGSYACTCNAGYKGNGNYLCLDIDECSETPYVCSSSLGYKGCKNLPGSYRCTCSRGFESN
GQSCVDIDECTDNICSLYADCVNTMGSYQCTCNKGFIGNGLTCADINECNEHNQCDPDAV
CINRLGSYECSCLEGYLGDGRQCEDINECATPDMCPSTTTCVNTGGSYYCDCGIGFIFNN
SMCYDLDECKTGRCSRFAACANSPGSFSCQCISGYRGDGFTCVDMDECLLAEQCHPNALC
INIPGSYNCTCWVGYTGDGVFQCNDVNECLVDNGGCANRATCVNNRGSFTCLCPSGFVLV
NKTLCQDIDECKELNNPCGVNEECKNNDGSFKCSCQVGYYRLANNMDCVDLDECKNNPCH
TNATCLNTIGSHTCTCKRGFSGNGTQCKDIDECSAKGTCHSRALCTNYIGSYFCTCQEGF
VGDGFFCEDVDECSLPETKCPSFSKCVNSPGAHVCSCLNSTLAVNDTCVLPSLLCEPACH
RHGLCHKSPAGYQCVCDQGYVGDGITCSDIDECQMENICPEKETECINTPGSFACVCRKG
YSLNSTTCLDVNECATGQQECSEFARCVNTIGSHSCFCLSGFTGDGKNCFDFDECQVQNG
GCHPVASCTNTPGLFFCACPPGMDGNGFDCQDVNECEQNASRPHNCSAQALCHNTNGSYT
CQCQDGYHGDGFACKDVDECQLTTTCDVNMKCTNTHGSYVCSCILGAVLCDPLARCHQQR
DSFYCQCVGGYEGSGTECLDVDECSQSQVCHAFSDCFNTNGSYFCDCWEGFQDNGTHCQD
LNECETGNVSCPANSTCTNTEGSYECICDSGFSANNSVCLDVDECDLGISQCPAFSKCMN
TFGSFVCDCWDGYHANNSYCEDINECQVNSTCPEHSMCINTNGSYLCVCNDGFSKVGELC
VDVDECSDAKMGELCTNGTCINVAGSYFCDCFKGFWGNGTTCEDIDECRASSNITVCQPN
SMCVNNPGSYYCPCNKGFILNGTQCQDVDECHDLDRWPCPQHGLCNNTAGSFFCLCSPGY
EATIDGCGDIDECKDNITCRFDQVCTNQPGGYECSCPSGFHEEKQTCVDTNECEKSPCHL
LAHCWNTPGSYSCHCPVGFAGNGSWCKDVDECDALSNPCHHQALCYNTPGSFLCVCNAGF
TSIGPLCVDLDECQQTNWHCHSTATCSNHVGSFECSCGQGWSITNLEDCKLGCVDLDECV
SPTICPGPTFCINLPGSYSCTCPSNNSM
Download sequence
Identical sequences H3DI89
ENSTNIP00000020233 ENSTNIP00000020233 99883.ENSTNIP00000020233

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]