SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTNIP00000020249 from Tetraodon nigroviridis 76_8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTNIP00000020249
Domain Number 1 Region: 277-410
Classification Level Classification E-value
Superfamily C-type lectin-like 8.92e-41
Family C-type lectin domain 0.00016
Further Details:      
 
Weak hits

Sequence:  ENSTNIP00000020249
Domain Number - Region: 9-97
Classification Level Classification E-value
Superfamily Methyl-accepting chemotaxis protein (MCP) signaling domain 0.0288
Family Methyl-accepting chemotaxis protein (MCP) signaling domain 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTNIP00000020249   Gene: ENSTNIG00000017114   Transcript: ENSTNIT00000020480
Sequence length 419
Comment pep:known_by_projection chromosome:TETRAODON8:6:5275393:5277754:-1 gene:ENSTNIG00000017114 transcript:ENSTNIT00000020480 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
KFERLEVRLEESEESIDHMTETISFTTHMLGSINLKLNELRTSSETVSRHSDFLLSLNNS
MTDVQTDAASLRAQQEELASRLDKEVTNLSFVMEEMKLVDTKHSQLITNFTILKGPPGPR
GPKGDKGSRGIPGQSGQKGDKGEKGAPGIQGPRGEQGIPGAPGLPGLKGLPGVPGSPGPK
GSRGSGGRAGPPGAKGEPGSAGLPGRDGQPGPQGAQGPPGIRGATGPPGEQGPRGLPGPV
GPPGPPGPPGLPGVPIRGPVAPVGLASMQDEAVAPSQWARGCPLEWLNYRDKCYFFSKDL
HSFDDAKTTCDSLSASLLVINDKEEQKWLRKQVQGKGYFWIGLTDKEEENVWRWLDGTQP
AFTMWKPGQPDNWGHGHDISGEDCAGLVHEALWNDFFCEDLISYICEKEPERLVAVSSI
Download sequence
Identical sequences H3DIA5
99883.ENSTNIP00000020249 ENSTNIP00000020249 ENSTNIP00000001777

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]