SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTNIP00000020274 from Tetraodon nigroviridis 76_8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTNIP00000020274
Domain Number 1 Region: 34-271,303-327
Classification Level Classification E-value
Superfamily BAR/IMD domain-like 2.22e-65
Family BAR domain 0.0016
Further Details:      
 
Domain Number 2 Region: 540-692
Classification Level Classification E-value
Superfamily Ankyrin repeat 1.42e-62
Family Ankyrin repeat 0.00000228
Further Details:      
 
Domain Number 3 Region: 418-535
Classification Level Classification E-value
Superfamily ArfGap/RecO-like zinc finger 1.83e-38
Family Pyk2-associated protein beta ARF-GAP domain 0.00000762
Further Details:      
 
Domain Number 4 Region: 295-408
Classification Level Classification E-value
Superfamily PH domain-like 1.23e-19
Family Pleckstrin-homology domain (PH domain) 0.0048
Further Details:      
 
Domain Number 5 Region: 1071-1130
Classification Level Classification E-value
Superfamily SH3-domain 7.88e-17
Family SH3-domain 0.001
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTNIP00000020274   Gene: ENSTNIG00000017139   Transcript: ENSTNIT00000020505
Sequence length 1131
Comment pep:known_by_projection chromosome:TETRAODON8:6:5686131:5711677:-1 gene:ENSTNIG00000017139 transcript:ENSTNIT00000020505 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
RMPDQISVSEFLSETTEDYNSPTTSSFTTRMQSCRNTVNVLEEALDQDRTSLQKVKKSVK
AIYNSGQDHVQNEENYAQALDKFGSNFISRDNPDLGTAFVKFSSLTKELSALLKNLLQSL
SHNVIFTLDSLLKGDLKGVKGDIKKPFDKAWKDYEAKFTKIEKEKREHAKQHGMIRTEIT
GAEIAEEMEKERRLFQLQMCEYLIKVNEIKTKKGVDLLQNLIKYYHAQCNFFQDGLKTAD
KLKQYIEKLAADLYNIKQTQDEEKKQLTALRDLIKSSLQLDQKEDSQSKQGGYSMHQLQG
NKEFGSEKKGYLLKKSDGLRKVWQRRQCSVKGGILTISHATSNRQPVKLNLLTCVKPSPE
DRKCFDLISHNRTYHFQAEDEQEFIIWISVLTNSKEEALNMAFGEQSSGGEDGLEDLTKA
IIEDVLRMPGNEVCCDCGAADPKWLSTNLGILTCIECSGIHREMGVHISRIQSMELDKLG
TSELLLAKNVGNSSFNEIMEGNLPCPSPKPTPSSDMTVRKEFINAKYVDHKYARKTCSSA
AAKMIELFEAVQSRDLLALIQVYAEGVELMEPLPEAGPEAGETALHYSVRTADQTSLHLV
DFLVQNSGNLDKQTEYGNTALHYCCMYEKPECLKLLLRGKPATDITNQNGETALDVARRL
RNTQCEEALVSLCRLQRAKFNPHIHVEYEWSLRLEEMDESDDDLDDKPSPIKKDRSPRPQ
SFCHSSSLSPHDKLSLPGFISQRDKQQRLSYSAFTNQMYSASTDLTTSPVADGPPLPPRN
QGKAPPAPPPSGPPSTLTPGGSSTLSKKRPPPPPPGHKRTLSDPPSPLSHSPHSKGGLTG
GSDSTPPPISKMSPVSNKFEGIPQQQSSTSSNTKSTLGPRVLPKLPQKVALRKIDTIHHP
SVDKSSQPPEVFPKSPPAADAPQKTPVADRPQLGDLPPKPQPSELPPKPGELPPKPQLSD
LPPKPQLGDLPPKPHLKDLPPKPHLADMPPKPGTADPAPRPPPGDTLQRPQTQPPPPPPQ
TQPQDSPSPNQQVTIATPPTPAAEDANGTPAGLAETPVPLPRKINTGKTKARRVKTIYDC
QADNDDELTFVEGEVIIVTGEEDQEWWIGHIEGDPERKGVFPMSFVHILSD
Download sequence
Identical sequences H3DID0
99883.ENSTNIP00000020274 ENSTNIP00000020274 ENSTNIP00000020274

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]