SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTNIP00000020279 from Tetraodon nigroviridis 76_8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTNIP00000020279
Domain Number 1 Region: 501-854
Classification Level Classification E-value
Superfamily L domain-like 2.45e-30
Family Internalin LRR domain 0.0016
Further Details:      
 
Domain Number 2 Region: 132-261
Classification Level Classification E-value
Superfamily Ubiquitin-like 6.2e-17
Family UBX domain 0.0066
Further Details:      
 
Domain Number 3 Region: 14-48
Classification Level Classification E-value
Superfamily UBA-like 0.0000211
Family UBA domain 0.017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTNIP00000020279   Gene: ENSTNIG00000017144   Transcript: ENSTNIT00000020510
Sequence length 897
Comment pep:novel chromosome:TETRAODON8:6:5747782:5751977:-1 gene:ENSTNIG00000017144 transcript:ENSTNIT00000020510 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MALCLQTIGELFLVLGEMGFTEEQIQAAVHAGHFSVSDATEWLLQGQYPHHTLVKQSSQP
SETAFSAFNPPKQSENTSDAHRGIQRTSLVLRPSQSCGPSSDPSPVESRIKQDKSDFEEQ
ERQRVTQEARAEKQQKKKERELVLKRIAEDRKSQQEKMQTGAASEKSPPGGQEQKLGGKI
QTNVDNNCLLMIRLPSGESMRERFPADAPLRSVVEHITGRHPSLPSFSLVQGFPRKRFGE
AELTCSLRSLGLTPNAALCIQTTPPETPHDTHSPADPPSAGQSAPSPCKASPQPRILAPE
GAEGQDPVVPPPLPNQLWEDAVNYAGIPGAGRSLFGPSHFWAALMFCGRVFIFSLVIPTG
MPRLPFFPENRFRGEFEPRHRWPEQGNRLRWEDAVEVEDAGAPGAPVAAGLAAVERLQRA
GHHEHPPTSQGQPSPPKRPFKTPSLPSLCALATRATLQLMSAPSMQYSSSLAGLTPELVE
LLLNHMSRERLLRPRSLELFFGCPLQKFVLNCYPYCTNELLRQLRAFPALRHLSLVNSPL
ITDSGLSVLSGLLKLQYLNLASCSKLTDSCLQHITGLKNLCFLSLDQTKVTDAGMVLYLH
SAPSCLAQLSLNQTAVTEATLAVLPSCTPQLRLLSIKQTKVRDVAALARLSGLHTLNLDG
TDVSESGLEHLASHPLLSSLSLAGISVTDGNQALQIISGLNLTQLTLPGRRSVTDSGLAS
VCRLTLLTELDLTDYTQVTDQGVAQLASMRRLKKLSLSNTQVTDAGLSPLRGLQELQDLC
LDRTAVTSRGVAALIACLPHLQVLGLACTQVGDTVVRRGLLRCPQLVKLNLSRTRITDNG
LKFLKRMHLAHVNLDGTGVSLAGIADLLTATNISSIRASNTRTLPLDEVSDEEWETP
Download sequence
Identical sequences H3DID5
99883.ENSTNIP00000020279 ENSTNIP00000020279 ENSTNIP00000020279

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]