SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTNIP00000020291 from Tetraodon nigroviridis 76_8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTNIP00000020291
Domain Number 1 Region: 355-618
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 3.37e-79
Family Protein kinases, catalytic subunit 0.0000152
Further Details:      
 
Domain Number 2 Region: 42-120
Classification Level Classification E-value
Superfamily CAD & PB1 domains 9.48e-33
Family PB1 domain 0.0000124
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTNIP00000020291   Gene: ENSTNIG00000017156   Transcript: ENSTNIT00000020522
Sequence length 619
Comment pep:known_by_projection chromosome:TETRAODON8:3:954274:957371:1 gene:ENSTNIG00000017156 transcript:ENSTNIT00000020522 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
SDEQEALNSIMQDLAELHRSSRPAVFPSDLGKPKASSPKNQNDIRVKFEFKGEKRILQFP
RPIKLDDLKAKAKVAFGQPMDLHYTNNELVIPLTTQDDLDKAVELLDRSVHMKSLKILLV
LQTLSQNSSSSMDLVPSREDLDNTGFRVADKKSVLALIGSHSTDRSSPPPGYIPDALQQV
ARNGSFTSINSEGEFIPESMDQQMLDPLSMSSPENSASGSCPSLDSPLDSDYPKSRMPRA
QSYPDNHQDFPEYDNPVFEKSGKGGTYPRRYGIPFGLQDYSDGRKTFPRARRTQVHGFRS
PVSFSPTEQSPSTSSGSSVFTPDLDPPGGLAGAATSNRLPPQRRLPPCRSSPRAPTNWRL
GKLLGQGAFGRVYLCYDADTGRELAVKQVQFDPESPETSKEVSALECEIQLLKNLCHERI
VQYYGCLRDTMERTLSIFMEHMPGGSIKDQLKSYGALTEKVTRRYSRQILEGVSYLHSNM
IVHRDIKGANILRDSVGNVKLGDFGASRRLQTICLSGTGIMSVTGTPYWMSPEVISGEGY
GRKADIWSVGCTVVEMLTQRPPWAEFEAMAAIFKIATQPTNPVLPAHVSDHCREFLKRIF
VETKQRPSADELLRHTFVH
Download sequence
Identical sequences H3DIE7
ENSTNIP00000020291

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]