SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTNIP00000020309 from Tetraodon nigroviridis 76_8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTNIP00000020309
Domain Number 1 Region: 450-485
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000213
Family EGF-type module 0.0079
Further Details:      
 
Domain Number 2 Region: 417-463
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000436
Family EGF-type module 0.02
Further Details:      
 
Weak hits

Sequence:  ENSTNIP00000020309
Domain Number - Region: 657-689
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00015
Family EGF-type module 0.015
Further Details:      
 
Domain Number - Region: 750-781
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00145
Family EGF-type module 0.034
Further Details:      
 
Domain Number - Region: 564-594
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00369
Family Integrin beta EGF-like domains 0.075
Further Details:      
 
Domain Number - Region: 782-815
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00381
Family EGF-type module 0.033
Further Details:      
 
Domain Number - Region: 332-411
Classification Level Classification E-value
Superfamily Cadherin-like 0.00596
Family Cadherin 0.066
Further Details:      
 
Domain Number - Region: 626-656
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00604
Family EGF-type module 0.03
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTNIP00000020309   Gene: ENSTNIG00000017172   Transcript: ENSTNIT00000020540
Sequence length 818
Comment pep:known_by_projection chromosome:TETRAODON8:3:372112:378081:-1 gene:ENSTNIG00000017172 transcript:ENSTNIT00000020540 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
PVLGHAQLDEFAYRSVEARQEAQPRWPTPSGLSRSKALVLCQLALANSTVGAACGGLLGR
RLDEAVDLCVLDLQLKDDLGWTEALLPYLENECERRLLENGTRRSLEGPDPAGAAAEVAA
ALRCPGRCHGHGECTPAGCRCSSSHSSYDCSRALAQPVELSHLENGGRCDLRSSSCDSVR
VFGRGFASSPGLSCLATRLKYVNGGWVPVERQRTRATFLSSGALDCAVPSLSNAGVNTED
LVLGDKPYARWEVQVSNDGSRHSQAKVLTIFDSVCQACEASPSGLCKLKETTCSIGGRCF
AEGHPNPSSPCLVCDPNTSQFSWSPNQANKPPTFHQPQDKLQSFAGENFVFQFTASDPEG
SALLFRLDGGPEGALLSPAGLLLWRVPTAYPVHVTLLDECNAQSSFTVEVVQVLPCRCQE
GATCVTDVAFPAGSGRYLCRCPHGRRGALCEQAVDECVSAPCTRGACVDTAGASRCECPP
GLRGEKHQPVCRVTSGSRTNVRPTEAVTDTSAGPAGRTESGPPRTGRVQPVCRRACGRNM
ECAAPNRCGCKGGYAGADCLTAVCQPACAHGGVCVAPGVCRCVPGFHGEACQQAVCRCEH
GGSCVGPHTCACPGFAGRRCQSALCSLHCRNGGRCVSAGACTCAAGWGGPPCETALCSPV
CLNGGSCLRPDVCKCPAGFYGNRCQHAVCSPPCRNGGVCVRKDVCWCRGHAGNRCQKSVC
QPSCMNGGRCVGPDVCDCPGWRGKRCDKPSCLQKCLNGGECVGANACRCAPGWQGTLCHI
PRCQQTCLYGSRCVRPNVCACRSGYSGTRCSQKVSHHH
Download sequence
Identical sequences H3DIG5
99883.ENSTNIP00000020309 ENSTNIP00000020309 ENSTNIP00000020309

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]