SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTNIP00000020314 from Tetraodon nigroviridis 76_8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTNIP00000020314
Domain Number 1 Region: 1070-1239
Classification Level Classification E-value
Superfamily C-type lectin-like 4.71e-66
Family Endostatin 0.00000207
Further Details:      
 
Domain Number 2 Region: 1-172
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 1.21e-22
Family Laminin G-like module 0.026
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTNIP00000020314   Gene: ENSTNIG00000017177   Transcript: ENSTNIT00000020545
Sequence length 1245
Comment pep:known_by_projection chromosome:TETRAODON8:3:331569:340625:1 gene:ENSTNIG00000017177 transcript:ENSTNIT00000020545 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
PSYRFSGAAVAGQPALAHVPSPFYRHFSLVFNVRPSSPDAAVLFAITDQPQRLVYVGVKL
GAERAGRQAVQFFYTEPDSDASYQAAVFAVPSLANSWTFALSVFEDQVTFYHGCEAAPQA
VRFERSPDPMELDPGARVFVGQAGQADAHRFRGDMAELRLVGDPQAAERLCDDEDDSDAA
SGDFGSGDGGVGVQTGYTLKVSLHPFRFDQPVPAPPLTASQKPTGRFNEKGQKGDRGEEG
SKGDLGTVGPKGEPGSGGGLRGEKGLKGDKGEKGSSGFGFPGKKGDPGVPGPPGLPGPPG
PAAEVVRLEDGSIVQHVPGPAGPPGSPGLLGRAGPPGSDGLPGVPGGDGKEGPPGPQGAP
GTPGSPGAKGQKGDPGEGQPGPRGPPGPPGPPGPGAADRQALTFLDMEGSGLADLDRIRV
RLSPGAQGPLGLPGPPGILGTLVALGPNGTIVLGPPGLPGLDGSTGLLFQGPPGPPGPPG
QPGLVGVKGDSGGRGLPGLPGEQGARGDPGRMGSPGQTGLAGLPGPMGPTGPPGPPGPPY
RGGLGLRDQLDSTTGLPGFTGPPGPQGPPGVAGFPGKAGLPGSNGEKGSEGPRGPPGIPG
ISGFPGQPGEKGDRGQRGERGPPGRDSGLPGPPGPPGPPGQIVYQPTNDGGSRTGGRLPG
RPGLPGPAGPKGDRGDSGPPGFAPKGQKGEPGIILDPHGTPLYLRGLQGESGPPGPVGPP
GPIGPPGQKGEIGLPGRPGRPGLNGAKGVKGDSGSGPGFGYPGPPGPPGPPGPPGASGAF
DRITSYEDLSRYFPALKGEKGDPGPAGRVEVSAFPGSGSLDINTLRTEMKGETGSPGLKG
EKGEPGGGYYDPRFGGSGSPGQPGPPGPKGDSIVGPPGPQGQPGQPGRGYDGRPGLPGPP
GPPGPPGGSNLGGSWDTPVSPGPPGPPGAPGLPGRSSGVTVFRTYDTMATAARRQPEGSL
VYVMDQTDLYLRVRDGLRQVYLGSYVALPEDDNQVAVEPPPVVLYSPDSDAGPSQPEGPA
QPPHPPTRHGPGDPHSQHPAHPDPRYHPDPRYPAPTDPRYPSYTERVNQPDLHLIALNGP
QTGAMQGIRGADFLCFTQAQAIGMKGTFRAFLSSRLQDLHSIVRRTDRERIPIVNLKDEV
LFDSWDAIFTQGGLKEGVPIYSFDGRDLLGDAAWPEKMLWHGSTGGGQRHTQGFCEAWRS
GEQSQSGMAAPLHSGSSLLQQHPGSCSSSYAVLCIENSYVGQARR
Download sequence
Identical sequences H3DIH0
ENSTNIP00000020314

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]