SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTNIP00000020317 from Tetraodon nigroviridis 76_8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTNIP00000020317
Domain Number 1 Region: 1341-1391,1432-1613
Classification Level Classification E-value
Superfamily VPS9 domain 2.09e-37
Family VPS9 domain 0.0024
Further Details:      
 
Domain Number 2 Region: 15-210
Classification Level Classification E-value
Superfamily RCC1/BLIP-II 3.01e-33
Family Regulator of chromosome condensation RCC1 0.04
Further Details:      
 
Domain Number 3 Region: 516-666
Classification Level Classification E-value
Superfamily RCC1/BLIP-II 1.7e-28
Family Regulator of chromosome condensation RCC1 0.049
Further Details:      
 
Domain Number 4 Region: 1077-1209
Classification Level Classification E-value
Superfamily Histone H3 K4-specific methyltransferase SET7/9 N-terminal domain 8.24e-23
Family Histone H3 K4-specific methyltransferase SET7/9 N-terminal domain 0.0076
Further Details:      
 
Domain Number 5 Region: 887-991
Classification Level Classification E-value
Superfamily PH domain-like 0.000000000000911
Family Pleckstrin-homology domain (PH domain) 0.033
Further Details:      
 
Domain Number 6 Region: 674-873
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 0.00000245
Family DBL homology domain (DH-domain) 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTNIP00000020317   Gene: ENSTNIG00000017180   Transcript: ENSTNIT00000020548
Sequence length 1616
Comment pep:known_by_projection chromosome:TETRAODON8:3:270094:279319:1 gene:ENSTNIG00000017180 transcript:ENSTNIT00000020548 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MESQRRMAHSSEDGGGDERGLLHIWKGYSCSVTPERTLLSRPVLQVALGTGHGLLLVEGG
QVYSFGELPWKQSQGPVVEKLTLETSLSGQQVVAIAAGSYHSGAVTEGGGVHMWGDNGSG
QCGLSALKTIANPTPVALLDPAGGRSQAVRVLELACGARHQLALSARREVWAWGSGCQLG
LNTSVFPVWKPQKVRQLSGRCVLQVAAGPSTAWPWCAPGPGGGAGPPPVDKCRQCQQLLY
TMTDKEDHVIISDSHYCVPAVEQDQDQDQDQDQDQDEAAQDALALAQPRPSLAATSRAAV
PQPASFPSRGAGAPGEPAPLQAASSGSARPPRLAPGYPDEQAVEDYPRELSDTQAQQEGG
AGSQTLIPQPSCRGAAAATPSSVLNSLVASCASAVGERVASTYEALSLRKVINYLPSGAA
RPGLPGGFPLVQSSKAAEPLWQEDAVQAKKSSSTGDIHEEEDQGLRRRLSLPGLLSQVSP
RLLRKAARPRMRTGALSSLEGELPEAQEAFPSLQTEVWSWGQGQHGQLGHGDLLPSRSQP
LCIKSLSSREVVQVSAGAAHSLALTAQSELFSWGSNSCGQLGHMESPSSVPRLAKLSEGV
RVWAAAAGDQHTLLLADGDCVQPIIYYSGQQGCTKQPVLLPFCMNLRYVSSVFAGGQRCA
ALSDQNAMGFIAGLHELASSERRFYGKLCTIKAQILGPLLDLEALASVLGKPTLGLLQTL
ATRFSLLCRLTGQHASSLSANVRRSRSVRSLLVLEHTSLFLDSYHQYCCAVANLQVMGGL
QALARPSLDFFGKSPELLQRLSECSEDSVAMPDLLAALFYLPMQHLPECSRLLLKLATCF
EVTSADHQRLQDASSRLDALALQLRRRRTDAEYTFHFWKSFPGKMTDSLKTPHRRLICES
SNKALTLQNAGRFSVNWFILFNDALVHAQFSTHHVFPLTTLWVEPLEENAGPSFGLKVIT
PEETFTLLASSLMDKTKWLRSIQQAVERALSGSGQDAASAASSSGHTPEPPDCRTASYTF
YKEGRPWKTGGPHTCSPPPVSIGELMLVQYRRADASTGELMLVQLNVDPPPTPVCRYANG
EVYEGAFKYNMRHGHGMFRSGKYLTSSPSVFIGQWLQDMKAGYGVFDDITKGEKYMGMWQ
DNQRHGPGVVVTQFGLYYEGAFKENKMMGSGILVAEDDTMYEGEFCDDWTLSGKGLLTMA
NSDYLEGSFSGEWGSGLKVTGSYFKPHLFDSAKDKPRPLRKLGRLCVRAEDKWRSVFQEC
WSQLGCGEPAQRDEQTAWDNIAAALTAFTCVFCPSPETLSRSQGQLLEGLDVLPQHAGPI
SVERYHAIRLYLVKACDSPAHPLARLLEALVAVYRMTYVGVGANRLLPQAVREIKSYLSR
IFQIVRLLFPELPEEGALIPDVNAAVPEQSEADASGAAALAPRPGVVVSSSSLLLPILLP
RLYPPLFTLYALDGERDEDVYWDRVLRLNKQPDLALLAFLGVQRKFWPVSIATQQEKQPQ
QVLSSTKDLCFSSAVETLQQISTTFTPSDKLQVIQLTFEEITQDVQVLLKQDFLWSMDDL
FPVFLYVVLRARIRNLGSEVSLIEDLMDPCVQHGEHGIMFTTLKACYYQIQHEKIT
Download sequence
Identical sequences H3DIH3
99883.ENSTNIP00000020317 ENSTNIP00000020317 ENSTNIP00000020317

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]