SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTNIP00000020346 from Tetraodon nigroviridis 76_8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTNIP00000020346
Domain Number 1 Region: 15-295
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 2.28e-71
Family G proteins 0.000000114
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTNIP00000020346   Gene: ENSTNIG00000017209   Transcript: ENSTNIT00000020577
Sequence length 296
Comment pep:known_by_projection chromosome:TETRAODON8:10:8817871:8819757:1 gene:ENSTNIG00000017209 transcript:ENSTNIT00000020577 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPPKKGEAPKPPPLIGRFGTSLKIGIVGLPNVGKSTFFNVLTKSQAAAENFPFCTIDPNE
SRVPVPDERYDFLCKYHKPASKVPAFLNVVDIAGLVKGAHSGQGLGNAFLSHINACDGIF
HMTRSFDDEDIIHVEGNVDPVRDIEIIHEELRLKDEEMIAPIIDKLEKVAVRGGDKKLKP
EYDILLKIRNWIVEEKKHVRFYHDWNDKEIEVLNKNLFLTSKPMIYLVNLSEKDYIRKKN
KWLAKIKEWVDAHDPGSLVIPLSGAFESKLLDMEEEERNKYCEEQKTQSVLTKIIK
Download sequence
Identical sequences H3DIK2
ENSTNIP00000020346 99883.ENSTNIP00000020346 ENSTNIP00000020346

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]