SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTNIP00000020349 from Tetraodon nigroviridis 76_8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTNIP00000020349
Domain Number 1 Region: 48-791
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 2.66e-264
Family Motor proteins 0.000000000137
Further Details:      
 
Domain Number 2 Region: 1140-1246
Classification Level Classification E-value
Superfamily PH domain-like 7.12e-29
Family Pleckstrin-homology domain (PH domain) 0.006
Further Details:      
 
Domain Number 3 Region: 1321-1428
Classification Level Classification E-value
Superfamily PH domain-like 1.15e-20
Family Pleckstrin-homology domain (PH domain) 0.012
Further Details:      
 
Domain Number 4 Region: 1723-1792,1844-1880
Classification Level Classification E-value
Superfamily Second domain of FERM 3.56e-16
Family Second domain of FERM 0.01
Further Details:      
 
Domain Number 5 Region: 950-988,1101-1141
Classification Level Classification E-value
Superfamily PH domain-like 0.0000000431
Family Pleckstrin-homology domain (PH domain) 0.013
Further Details:      
 
Domain Number 6 Region: 1257-1311
Classification Level Classification E-value
Superfamily PH domain-like 0.0000000482
Family Pleckstrin-homology domain (PH domain) 0.0063
Further Details:      
 
Weak hits

Sequence:  ENSTNIP00000020349
Domain Number - Region: 1639-1717
Classification Level Classification E-value
Superfamily Ubiquitin-like 0.00878
Family Ras-binding domain, RBD 0.026
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTNIP00000020349   Gene: ENSTNIG00000017212   Transcript: ENSTNIT00000020580
Sequence length 1987
Comment pep:known_by_projection chromosome:TETRAODON8:10:8727403:8742392:-1 gene:ENSTNIG00000017212 transcript:ENSTNIT00000020580 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
FDVSVMQGARVWVREKELLLPATVNSCGDGTLVITTDYGEVLYLQQAEVTRERVYAMHQS
SIDGVEDMSALAELHEAAIMHNLYQRYQKDNIYTNIGSILAAVNPYKQIPGLYDLDRVDL
YSKHHLGELPPHIFAVANECYRCIWKRHDSQCVLISGESGAGKTESTKLLLQFLSVMSQN
SAGAPSSEKSTRVEQAIVQSSPIMEAFGNAKTVYNNNSSRFGKFIQLHFSECGNIQGGCI
IDYLLEKNRVVRQNPGERNYHIFYALLAGATKEHKNLYFLEDSPELFHYLSQSGCLKDKS
LNDKELFNSVMEALKVLQFTEEEIRDMFKLLSGVLQLGNIEFMTAGGAQITTKQVVTNAS
ELLGLDAFQLSEVLTQRSIILRGEEICSPLTIEQAVDSRDSVAMALYSQCFSWIILKINQ
KIKGKENFKSIGILDIFGFENFEVNRFEQFNINYANEKLQEYFNKHIFSLEQLEYNREGV
QWDAIDWMDNAECLDLIEKKLGLLALVNEESRFPKGTDFTLLEKLHSRHSTNPYYVKPRL
ADHQFGIKHYAGEVLYDVKGILEKNRDTFRDDILNLLKDSRLDFIYDLFEKVGSRNNEEK
MGTARRKPTVSSQFRDSLHALMATLSVSNPFFIRCIKPNMEKNPNVFDPEVVLNQLRYSG
MLETVKIRRAGFPVRRTFRDFFSRYKIIMKDRDDKKKSTDLLIKYDKTKKEWQLGKTKVF
MKESLEQRLEKDRDEVRCQAAMIIRAHLLTFSAKKHFKRVRASVVTLQKHLRRHVQRKRF
VKQREAALVLQRHRRGQVARAQARKLRALGKEEQETDETDEKKDETRQMEEILQLEREIE
RLQKKRENEVSQLCESSRQELQLRRDAELKRMKKEASRKATGLIDLLNFKGVDPSQGDAS
AKPAAEVKPQNAVIAACGSSKEEEIDEGFHAEEECIPLPDFPPPAETDAPLDDAPIVGIP
PPPPLPPPGDSVDVPPPPPSEAEGVKMEPERKVSMVESLVDGDEPIYSMPADTESDYDQE
EEEGSVTAGDDSSVSGSNRGSAAVTDEEHPRKSTCTNASAESYRGSSDSVRTHYADSEDE
HDGMMDTDEEVTNGRVTLFNGNGPPYFHGYLYMKAGLMIPWRRRWCVLKDETFMWFRSKQ
ESLKSGWLYKKGGGLSTLSRRNWKMRWFVLRDSKLMYYDNDSEEKLKGTIDIRAAKEIVD
NHEKENALNIVTDERTYQVFAESPEDASGWFNVLSKVRVCTPEQLLDMSHEQANPKNAVG
TLDVGLIDSVCASDNPDRRPNSFVIITANRVIHCNSDTPEEMHHWISLLQKPKGDARIDG
QEFLVRGWLQKEVKTNAKSTSLKLKKRWFVLTHNSLDYYKSSEKNSSKMGTLVLNSLCSI
IQPDERVHRETGYWNIIVYGRKHSYRLYTKMLNEAMRWTAAIQGVIDSKTPIETPTLQLI
RDIKENSVNPEIVEQMYRRNPILRYTQHPLHAPLLPLPYGEVTSVQRQQGYASLQDEAVR
VFNSLQEMETLADTVPIIQGILQTCQDLRPLRDEVYCQVIKQTNHVPQPNSPANRAHWHL
LTCMSCTFLPSRAILRYLRFHLKRVRERFPGTEIERYASFIGESLKKTKTREFVPSQEEI
AALLLRQEMSTTVNCHGGGSCKISINSHTTAGEVVEKLIRGLAMEDSKNLFSLFEHNSVT
DRALESRVIVADVLAKFERLAGSEEEEEEGEWKLYFKLYCFLDVESVPKEGVEFAFMFEQ
AHESLISGHFPASEETLQHLAALRLQYLHGDGAGRAGWSLGSVYPIGRLRNRILHSTKTG
VGTARVEKRKTPSFLDGTLRRSFKTGSLKKQKVEEEQMLEMWVKEETSATRTSVLEKWTR
LQGMPQHQAMLKYMSIIKEWPGYGSTLFDVECKEGGFPHDLWLGVSADNVSVYKRGEPKP
LETFQYEHITFFGASSIYTYKIIVDEREMFFEAPLVGEITKIMRAYINMMVKKRCSIMSV
TSVASSW
Download sequence
Identical sequences H3DIK5
ENSTNIP00000020349

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]