SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTNIP00000020350 from Tetraodon nigroviridis 76_8

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSTNIP00000020350
Domain Number - Region: 38-65
Classification Level Classification E-value
Superfamily Plexin repeat 0.00994
Family Plexin repeat 0.0059
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTNIP00000020350   Gene: ENSTNIG00000017213   Transcript: ENSTNIT00000020581
Sequence length 176
Comment pep:known_by_projection chromosome:TETRAODON8:10:8721743:8724773:-1 gene:ENSTNIG00000017213 transcript:ENSTNIT00000020581 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LNRRPTGGLMDSRLFISAGLLLLGLATVVAESNPPGQACESKNGTSCEECLKNVTCLWCI
TTKSCVTYPVKTILPPHDLCPLNDARWGLCWMNFQALIISLAVIGGIIIIAFFVCLFCCC
KCENFGRTKRFEAKMQRQASKLKTKQEQRKAEMKQRHEEIRQKYGLSGPNPYSKFA
Download sequence
Identical sequences H3DIK6
ENSTNIP00000020350 99883.ENSTNIP00000020350 ENSTNIP00000020350

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]