SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTNIP00000020370 from Tetraodon nigroviridis 76_8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTNIP00000020370
Domain Number 1 Region: 562-650
Classification Level Classification E-value
Superfamily PH domain-like 4.06e-18
Family Third domain of FERM 0.0043
Further Details:      
 
Domain Number 2 Region: 377-470
Classification Level Classification E-value
Superfamily PH domain-like 2.16e-16
Family Pleckstrin-homology domain (PH domain) 0.0075
Further Details:      
 
Domain Number 3 Region: 273-318
Classification Level Classification E-value
Superfamily Second domain of FERM 0.0000000654
Family Second domain of FERM 0.011
Further Details:      
 
Domain Number 4 Region: 526-561
Classification Level Classification E-value
Superfamily Second domain of FERM 0.0000327
Family Second domain of FERM 0.0041
Further Details:      
 
Weak hits

Sequence:  ENSTNIP00000020370
Domain Number - Region: 28-91
Classification Level Classification E-value
Superfamily Ubiquitin-like 0.0444
Family Ubiquitin-related 0.029
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTNIP00000020370   Gene: ENSTNIG00000017234   Transcript: ENSTNIT00000020602
Sequence length 673
Comment pep:known_by_projection chromosome:TETRAODON8:10:8436534:8458591:-1 gene:ENSTNIG00000017234 transcript:ENSTNIT00000020602 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MALDGIRMPDGCYADGTWELKMHVTDLNRDVSLRVTGEIHVGGVMLKLVEKLDVKKDWSD
HALWWEKKKTWLLKTHWTLDKYGIQADARLLFTPQHKLLRLQLPNMKHMKVKVNFSDRVF
KAVSDICKTFNIRHPEELSLLRKPRDPKKKKKLKKDDLEMEGPLLTPGSGSIYSSSGLYS
KTMTPTYDSRDGSPLSPTTAWFGDSPLSEGNPSILAVSQPISSPDILVKLYKPQSLLDKA
KINQGWLDSSRSLMEQDVKENEVLLLRFKYHSFFDLNPKYDAIRVNQLYEQAKWAILLEE
IECTEEEMMMFAALQYHINKLSIMSSDNHMNNSEKEVDEVDAALSDLEITLEGGKTSNTL
GDITSIPELADYVKVFKPKKLTLKGYKQYWCTFKDITISCYKSKEESHGTPAHQMNLRGC
EVTPDVNISGQKFNIKLLIPVADGMNEIWLRCDTEKQYAQWMAACRLASKGKTMADSSYN
LEVQNILSFLKMQHMNPDPQFIEPISTDINPECLVSPRYLKKYKNKQISARILEAHQNVA
QMSLIEAKMRFIQAWQSLPEFGITHFLAKFQGGKREELIGITYNRLIRMDANTGDAIKTW
RFSNMKQWNVNWEIKMVTVEFADEPSLSFICAEVDCKVVHEFIGGYIFLSTRAKDQNESL
DEEMFYKLTSGWV
Download sequence
Identical sequences H3DIM6
ENSTNIP00000020370 99883.ENSTNIP00000020370 ENSTNIP00000020370

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]