SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTNIP00000020403 from Tetraodon nigroviridis 76_8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTNIP00000020403
Domain Number 1 Region: 541-692
Classification Level Classification E-value
Superfamily Ankyrin repeat 5.8e-61
Family Ankyrin repeat 0.0000121
Further Details:      
 
Domain Number 2 Region: 33-268,303-328
Classification Level Classification E-value
Superfamily BAR/IMD domain-like 7.59e-56
Family BAR domain 0.0021
Further Details:      
 
Domain Number 3 Region: 421-539
Classification Level Classification E-value
Superfamily ArfGap/RecO-like zinc finger 4.05e-37
Family Pyk2-associated protein beta ARF-GAP domain 0.00000884
Further Details:      
 
Domain Number 4 Region: 269-401
Classification Level Classification E-value
Superfamily PH domain-like 6.82e-23
Family Pleckstrin-homology domain (PH domain) 0.0055
Further Details:      
 
Domain Number 5 Region: 855-937
Classification Level Classification E-value
Superfamily SH3-domain 0.0000000000000289
Family SH3-domain 0.0014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTNIP00000020403   Gene: ENSTNIG00000017265   Transcript: ENSTNIT00000020635
Sequence length 939
Comment pep:known_by_projection chromosome:TETRAODON8:10:7444552:7458516:-1 gene:ENSTNIG00000017265 transcript:ENSTNIT00000020635 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLERLSVSDFVVMTNEDLSSPGTSGFLSKMSDCRNTVSAVEESLEMDHLTLQKMKKMIKS
IHTSGLSHVENKEQYTEVLENLGNSHLTQDNNEVSTGFLNLAVFTREVTALFKNLVQNLN
NIMAFPLENVLKSELRDNRLELKKQMEKSWKEYDIKIGKLEKERKEKSRQLGLIRTEGSD
GGEDMERERRTFQLQMCEYLLKIQDLKVRQGPDLLQSLIKYFQAQLSFFQDGLKAAENLT
PFVEKLAASVHTVRMDQDEDVKKLTNLRDSLRLLLQVEGKEEYLNRKNSGNGYSIHQPQG
NKKYGTEKSGFLLKKSDGIRKVWQKRKCGVKFGCLTISHSTINRPPAKLNLLTCQVRPNP
EDKKTFDLVTNNRTYHFQAEDEQECLIWVSVLQNSKDEALNTALGGDQLHLQDSGLQELS
RAIISELRQMPGNDSCADCGAPDPTWLSTNLGILTCIECSGIHRELGVHYSRIQSLTLDL
LSTSELLLAVSIGNSRFNDIMEAGLPNDSVKPLPQSDITTRNARKEYIVAKYAERRYVVH
REEADPSRLYDAVRSRDLTSLLQLYAEGADLSKPLVLPDGQGIKETALHLAVRLEEKSSL
ALVDFLCQNSNCLEKRTAEGNTALHYSVLHHKPESLKLLLKAKAALHTVNSAGDTALDTA
RRLQHTQCVDLLELAHNGKFNSQIHVEFMWETHSQEFYDSEDDLDERVSPLPKNRSPLSS
NGSGGSNFASWSTTNGSSGGAGSRPCQTYENLDFLYKNPSANGASAPPPLPAKVIQRDLI
FIFACFSFSSTGRSDPQISVTAQEGTPNSRRFSNLPSHSSPQTQTKNSSSLPSTESQGGK
PPKSPHGQGVAAPAPARPSSPVQSCIPRPRRNAMVRPHQKLVKALVDCRAVSFEHLAFFK
DEIIVVTSTSDPHWWVGHIEGDPSRSGTFPVNYVHKLTD
Download sequence
Identical sequences H3DIQ9
ENSTNIP00000020403 ENSTNIP00000020403 99883.ENSTNIP00000020403

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]