SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTNIP00000020405 from Tetraodon nigroviridis 76_8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTNIP00000020405
Domain Number 1 Region: 263-492
Classification Level Classification E-value
Superfamily PH domain-like 5.63e-31
Family Pleckstrin-homology domain (PH domain) 0.0037
Further Details:      
 
Domain Number 2 Region: 2-74
Classification Level Classification E-value
Superfamily SAM/Pointed domain 0.00000000000000126
Family SAM (sterile alpha motif) domain 0.0031
Further Details:      
 
Domain Number 3 Region: 223-283
Classification Level Classification E-value
Superfamily PDZ domain-like 0.00000249
Family PDZ domain 0.032
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTNIP00000020405   Gene: ENSTNIG00000017267   Transcript: ENSTNIT00000020637
Sequence length 645
Comment pep:known_by_projection chromosome:TETRAODON8:10:7392260:7406223:-1 gene:ENSTNIG00000017267 transcript:ENSTNIT00000020637 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEPITAWSEERVSQWLQGLDAPLQQYPTSTWHLSGMDLLQLTSKDLENLGVNKIGHQELI
LEAVEKLCFLMYGIGGESLLNLTEKLRAVSHTLQMGIQGRWRINSYDGGRTTKLSSGVLQ
LVVELIIAAKGLLSLLNRYQFFQLTEASINKTIFTYCKELGDIVHKNSTALEKEKDIISV
CRQVTAVCDDILASSSEALLTHTTQLESVDLVPVSGIEIASTGSSNHYVTGAAAEASSDV
FLKVLAGDEVIQVNDQIVVGWSRANLIKKLQENPNRVTLVLKKISDNYTSPWEFDSLRLS
PRPREDRSPSPRSPSPFQPIRSPSPQDFHPDTASISSCPEMVGQMVREEAKAKKDREKSS
LKGKSNICSSVFAGMTTTMSRRRVSCRELGMPDCDGWLWKKRKESSVFIAQKWQRFWFIL
KGPALYWYSSQQQDEKAEGFINISSYNIESAGEHKRKYVFKMCHQRFQNFFFAAENVSDM
SKWINCLIATIQKHKKHKGPDSEEECYSETESESERSPSPRRKKANTLPRQKWKTNRSPL
PSPLTGGSKGTVDEMGVMMNSIKEGGVSLTGQEQPFTHDHFRRSFIRRCKNPVINEKVHV
LRTLQSTLKAKEAELLQINRILEESELTASKFRQWKEHNEELVQE
Download sequence
Identical sequences H3DIR1
ENSTNIP00000020405 99883.ENSTNIP00000020405 ENSTNIP00000020405

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]