SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTNIP00000020420 from Tetraodon nigroviridis 76_8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTNIP00000020420
Domain Number 1 Region: 171-208
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000223
Family EGF-type module 0.01
Further Details:      
 
Domain Number 2 Region: 131-174
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000248
Family EGF-type module 0.018
Further Details:      
 
Domain Number 3 Region: 89-134
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000706
Family EGF-type module 0.021
Further Details:      
 
Domain Number 4 Region: 211-250
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000458
Family EGF-type module 0.015
Further Details:      
 
Weak hits

Sequence:  ENSTNIP00000020420
Domain Number - Region: 63-86
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00496
Family EGF-type module 0.052
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTNIP00000020420   Gene: ENSTNIG00000017282   Transcript: ENSTNIT00000020652
Sequence length 392
Comment pep:known_by_projection chromosome:TETRAODON8:10:7222623:7227489:-1 gene:ENSTNIG00000017282 transcript:ENSTNIT00000020652 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LTLTQRYLGVFCALFCRRESLKGWRCSAECNIENGFCEKPGKCRCKPGWQGENCDQCVPF
PGCLHGKCEKAWQCVCEEGWVGSLCDQDTRLCSSKPCAGNATCIETGQGGYMCICPRGYM
GENCQLKPGLCFSNSSPCRNGGTCVDADGPSAYSSCSCPPGFSGDFCEIPLDSCQPNPCL
NGGNCTSRGLAFTCACQHGFTGFTCNKSASASPCAGAPCSNRGTCVGQPDGTFRCICPRW
FKGPTCALQQRSKVSSRPVDREVFALTPQHYSLPAHTFHKLLRPPERDLLKITLKETVHS
RGVLVTHGQLVCFGMLALITCLVILGTTGIVFFGRCETWLANVRYSRLVRQQREHLLREA
GGVTLEEPEHSVNIILPEKIRLTSFGRHYTSI
Download sequence
Identical sequences H3DIS6
ENSTNIP00000020420 ENSTNIP00000020420 99883.ENSTNIP00000020420

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]