SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTNIP00000020431 from Tetraodon nigroviridis 76_8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTNIP00000020431
Domain Number 1 Region: 878-1154
Classification Level Classification E-value
Superfamily RNI-like 1.65e-40
Family 28-residue LRR 0.005
Further Details:      
 
Domain Number 2 Region: 356-475
Classification Level Classification E-value
Superfamily Ankyrin repeat 2.02e-31
Family Ankyrin repeat 0.00023
Further Details:      
 
Domain Number 3 Region: 3-130
Classification Level Classification E-value
Superfamily TPR-like 5.31e-16
Family Tetratricopeptide repeat (TPR) 0.018
Further Details:      
 
Domain Number 4 Region: 147-276
Classification Level Classification E-value
Superfamily TPR-like 0.000000353
Family Tetratricopeptide repeat (TPR) 0.018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTNIP00000020431   Gene: ENSTNIG00000017293   Transcript: ENSTNIT00000020663
Sequence length 1188
Comment pep:known_by_projection chromosome:TETRAODON8:10:7061358:7067515:1 gene:ENSTNIG00000017293 transcript:ENSTNIT00000020663 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MKARLFLNLGLVYDHLGEPKLCSEFIRRTVFIAEKSELLEDLYRANFNLGNIYFRNGQKP
NAVRCLEQAKECARKMKDKYGESECFHCIGKVQLSLGDFVAARRSLKKALLLGSQQNVDR
QSVKKAFKYADRGCKLEEELGEDQASRPSSHQAVGLAEQLDLYCKVGCYSKALDAYQAQL
KGAEALGKPARELAVIHVSLAATYTDLRQHGRAVEHYEQELALRQGSPAEDCSTWLNVAA
AQEESGCPCEEVDSSYTKASNCAQKSGQARLQKRTLRLWLAFQRRHGVCLSKDTEAKLLE
LCAAEGWNPDGSDGEDEEEEMDNSEPLEDSDVVLSDSDDDLEGYDKMVSGRRKTGRWNKR
NEKGETSLHRACIDGNLKQVQYLVEQGHPVNPRDYCGWTPLHEASNHGHHEIVAVLLGHG
ANVNDAGGPLCEGVTPLHDALSCGNFKVAQLLVERGAAVTLQNSKGYTALDTLHQWQRMY
SGELDQEARQDCVATEKLLRRALAGGGPAAPAPARPFDTLQDSQLFDAENSEPLPASGGA
ASSSQDWLQNNRDGVTAPASPGRWRGGGSTRRHRQRGTESAVLPSPESLPNTDANAVPIS
GREHAKEPPAASVFEREEYQSAIRGLGSAKTRLLAQPHPQLASTPAVSSSSTSALVPEEE
YVADDWLDDDLDAIQPKKKRRVRLEQNGIRGEDTSSSSAARALHRSTNSDIVSRGRSEVT
FHVCNCRLHTTGPSSSSRGPSVRKNSSAKPQQPPTVPSSLPPPIRVRVRVQEDVFLIPVP
QSEADSCTVSWLCEQASQRYYHKCGLLPRLSLQKEGALLSPQDLLLAVLHTNEEVLAEVC
SWDLPPLPERYKKACQSLAVDENTRVTRLCEVQDRSASVSVCGLCLGPSSLSPLLRALKL
QSSLTELRLSGNRLHDELLPELIATTATMPRLQVLDISACRVTAEGLEKAVNAFKGQNQA
PFPCLEELNLGMNPLGDGVSEALSCLLSGCPVLARLSLQACQLTARFLQQHRLLLASALA
GGGHLRSVCLSHNALGSTGLELVLKTLPLHCLTRLDLSAVRRSAADFLPLQHLSYALSQE
ECVLTHLSLAANGLTDANVATLARCLASCPTLVSLDISGNPQVTSAGLQNILTQLKESSR
PLTLLNLEGCQVSGPWDAAALDGLSDLVQDLRLCSQALNKLDRQALKQ
Download sequence
Identical sequences H3DIT7
99883.ENSTNIP00000020431 ENSTNIP00000020431 ENSTNIP00000020431

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]