SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTNIP00000020447 from Tetraodon nigroviridis 76_8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTNIP00000020447
Domain Number 1 Region: 23-413
Classification Level Classification E-value
Superfamily Ankyrin repeat 1.41e-95
Family Ankyrin repeat 0.00000606
Further Details:      
 
Weak hits

Sequence:  ENSTNIP00000020447
Domain Number - Region: 1226-1274
Classification Level Classification E-value
Superfamily SAM/Pointed domain 0.000558
Family SAM (sterile alpha motif) domain 0.061
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTNIP00000020447   Gene: ENSTNIG00000017309   Transcript: ENSTNIT00000020679
Sequence length 1619
Comment pep:known_by_projection chromosome:TETRAODON8:10:6415349:6441843:1 gene:ENSTNIG00000017309 transcript:ENSTNIT00000020679 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
TTTSLKMTSVAVQSLFTFVEEDNLAAVKAHLDKFRDVDSRSDNGQTPLMVAAEQGNLEIT
QELIRRGANVNLDDVDCWTALISAAKEGHIEVVKELLENSANLEHRDMGGWTLMWAAYKG
RTDVADLLLDKGANPNITGQYSVYPIIWAAGRGHAEIVHLLLQHGAKVNCSDKYGTTPLI
WAARKGHYESVMHLLSNGADVDQEGANSMTALIVAVKGGYTDVVKELLKRNPNVNVTDKD
GNTALAIAAKEGHVEIVQDLLDAGSYVNIPDRSGETMLIGAVRGGHVEIVRALLNKYADI
DIRGQDGKTALYWAVEKGNVTMVRDILQCNPDTESCTKEGETPLIKATKMRNIEIVELLL
DKGAKVSAVDKKGDTALHIAIRGRSRKLAELLLRNPKDGRLLYRPNKAGETPYNIDCTHQ
KSILTQIFGAKHLSPSESDGDMLGYDLYSSALADILSEPTMQPPICVGLYAQWGSGKSFL
LKKLEDEMKTFAGQQIEPLFQFSWLVVFLTLLVCGSVSLVLGFTVDHKLAIAVSLSLLGL
LYIFFVLVYFGSRRERESWNWAWTISTRLARQIGYLELLLKLMFVNPPELPEQTTRALPV
RFLFTDYNRLSSVGGETSMAEMIATLSDACEREFGFMAARLFRVFKNDEVQGKKWKKTCC
VPSFILFALTLGCLITGMALLAIFKVDPGNLTVNAVLIAMASVVGLALLLNCRTWWQVAD
SVFNSQRKRLHSAANNLHRLKSEGFMKVLKQEVELISKMAKTIDGFTQNQTRMAIIIDGL
DACEQDKVLQMLDTVRVLFSKGPFISIFASDPHIIIKAINQNLNSVLRDSNINGHDYMRN
IVHLPVFLNSRGLSTAKKLCMVTPTNGEPLPSDGWHEDSERKMSLTSLGQEQFKFGSKNA
LNRRDTYRRRQMQRTITRQMSFDLTKLLVSEDWFSDISPQTMRRLLNIVSITGRLLRANH
IVFNWDRLASWIHLTEEWPYRTSWIILFLEETDGVSDQITLKTLYERISKNIPMTKDVEP
LLEIDGDIRSFEVFLSSRMPVLTARDVEMFLPCTVNLDPKLREIIADVRAAREQINLGGV
TYPTLPLQDAGPRPQSMYGQASVACSPTVAFARPLPPQPHSSYFSGMTGPQHPFYNRPYF
PQHVYHQPRHYSHHVPSSTRPSVKLCGQPKDSTSGLGVIAEDTREVLSSPPSEAATAEPT
IQPAVLLSTMNTDAVCELVKQIDGIDTAMLPQYTAIIKKANVNGRVLAQCNLDDLKKEME
MNFGDWQLFRNTVMEQRHAEAQAVILDESRAASEQGSVTHHAEPKRRSGAIQQDAAAFSL
NLSFEELSGAGLEEPPRPSNNSQWTVANLRTSSMSSLNSQESSNDICRLTDKQQAEYRDA
YREYISQMSQLEMAGSGADRPHPGQFIQAGSSEDKSVGGESSCLRSITSKAKDGADQDGR
KSFTKRGSKAGDVPDFPSGADSQLLDTIREEDENHSASSRTPGTKKKGVGPLYQNLLNDE
ESGPEEADTTTPLLHKEASHSSFQQDELPSKPGFFFEISLDKKDSSDSGMRSSNSSSDRS
LGEAEGDGIELELEGLVKKRGLLPSSLSGLPDATVARMSICSEAPSEVSLMASSPEEGW
Download sequence
Identical sequences H3DIV3
99883.ENSTNIP00000020447 ENSTNIP00000020447 ENSTNIP00000003481

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]