SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTNIP00000020449 from Tetraodon nigroviridis 76_8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTNIP00000020449
Domain Number 1 Region: 546-697
Classification Level Classification E-value
Superfamily Ankyrin repeat 2.1e-69
Family Ankyrin repeat 0.000000234
Further Details:      
 
Domain Number 2 Region: 32-270,306-331
Classification Level Classification E-value
Superfamily BAR/IMD domain-like 2.44e-69
Family BAR domain 0.0015
Further Details:      
 
Domain Number 3 Region: 423-542
Classification Level Classification E-value
Superfamily ArfGap/RecO-like zinc finger 1.24e-36
Family Pyk2-associated protein beta ARF-GAP domain 0.00000366
Further Details:      
 
Domain Number 4 Region: 304-411
Classification Level Classification E-value
Superfamily PH domain-like 3.34e-21
Family Pleckstrin-homology domain (PH domain) 0.0058
Further Details:      
 
Domain Number 5 Region: 886-945
Classification Level Classification E-value
Superfamily SH3-domain 1.97e-16
Family SH3-domain 0.0012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTNIP00000020449   Gene: ENSTNIG00000017311   Transcript: ENSTNIT00000020681
Sequence length 946
Comment pep:known_by_projection chromosome:TETRAODON8:10:6367423:6391770:-1 gene:ENSTNIG00000017311 transcript:ENSTNIT00000020681 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPDQITVSEFVAETNEDYKSPTASNFTTRMSHCRNTVAALEEALDVDRSVLYKMKKSVKA
IYTSGLAHVENEEQYTQALEKFGENCVYRDDPDLGSAFLKFSVFTKELTALFKNLFQNMN
NIITFPLDSLLKGDLKGVKGDLKKPFDKAWKDYETKVTKIEKEKKEHARQHGMIRTEISG
AEIAEEMEKERRFFQLQMCEYLLKVNEIKIKKGVDLLQNLIKYFHAQCNFFQDGLKAVDN
LKPSIEKLATDLHTIKQVQDEERKQLTQLRDVLKSALQVEQKESRRDSQVRPSTTYSLHQ
PQGNKEHGTERSGYLYKKSDGLRKVWQKRKCTAKNGYLTISHGTANRPPAKLNLLTCQVK
HNPEEKRSFDLISHDRTYHFQAEDDQDCQIWISVLQNSKEEALNQAFKGDQHVGENNIVQ
ELTKAILVEVKRMTGNDVCCDCGAPNPTWLSTNLGILTCIECSGIHRELGVHYSRIQSLT
LDVLSTSELLLAKNVGNAGFNEIMEACLSAENVVKPTRPAICEQVRKDFITAKYTEKRFA
RKKCPDTTSRLHTLCDAVKARDIFSLIQVYAEGVDLMEPIPLANGHELGETALHLAVRLV
DRTSLHIVDFLTQNSLNLDKQTVKGSTALHYCCLTDNSECLKLLLRGKASIDIANEAGET
PLDIARRLKHVQCEELLNQALAGKFNAHVHVEYEWCLQHEDLDESDEDLDEKLQPSPLRR
DERPVSCYTPSNNASLGSAGLMKDKQRAFLPSLVNNETYGTILLVSVWRSASRAEEESVA
PPLHPPTVTSNHTRTETTGLWSTSLVLLSGLGGPGQSPASGSWKSDPPNMHPPVPPMRLV
SAGVSSPLSFPPPVPAKEVPGCPQNSGGQSLPPAPLLRKTFHKQRPKRVKAVYNCVADNP
DELTFAEGEVIVVDGEEDQEWWLGHIEGEPMRRGAFPVTFVHFISD
Download sequence
Identical sequences H3DIV5
ENSTNIP00000020449

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]