SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTNIP00000020505 from Tetraodon nigroviridis 76_8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTNIP00000020505
Domain Number 1 Region: 2-255
Classification Level Classification E-value
Superfamily Ankyrin repeat 4.04e-63
Family Ankyrin repeat 0.00011
Further Details:      
 
Domain Number 2 Region: 190-395
Classification Level Classification E-value
Superfamily Ankyrin repeat 1.78e-37
Family Ankyrin repeat 0.00019
Further Details:      
 
Domain Number 3 Region: 483-527
Classification Level Classification E-value
Superfamily SOCS box-like 0.0000000288
Family SOCS box-like 0.0044
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTNIP00000020505   Gene: ENSTNIG00000017367   Transcript: ENSTNIT00000020737
Sequence length 527
Comment pep:known_by_projection chromosome:TETRAODON8:10:5797620:5799705:1 gene:ENSTNIG00000017367 transcript:ENSTNIT00000020737 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
DPLVFAIRQGDLKAFNDVATSAAHCLLREDQDGWMPLHDAAFCGQTECAKTILKAHPSLV
DKRTLQEQTALLLAVSGQHLSCARCLLEGGADPDISSKNKETPLYKACELENMDLVRLLL
SYGATVNQRCAQGWTALHEAVSRDNTEICETLIRAGASVNPSNTYSMAPLTVAAQRGQLR
ALCHLIERAAGADVNMQTCDGLTPLHEASRHGHTETVSALLSKHADANRAAASGLLPLHV
AAQQGHPQIVSLLVPVTSRARLRHSCVSPLHLAAERNRRAAAAVLLQTGADVNATLGPSC
SLRYADGRATALYFAVANGGTETAELLLNAGASLTLDPVSPLLAAVRQGSVRSVSLLLER
GADANARIPSFTTFPSAVALCRNNLPLLRCLLDHGCDAVSCFTCTHGSAPHPGIEESQSG
DVHSGHVLHSRSCSQPPFCQWISAGDMRQWAGPVLDLLLEHVAQVQPCSRLLELLDSREE
WLPVRRKSLSPRPLQHLCRLQIRSHVGRPRLKRVRSLPLPDRLIRYL
Download sequence
Identical sequences H3DJ11
ENSTNIP00000020505 ENSTNIP00000020505 99883.ENSTNIP00000020505

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]