SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTNIP00000020537 from Tetraodon nigroviridis 76_8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTNIP00000020537
Domain Number 1 Region: 21-148
Classification Level Classification E-value
Superfamily E set domains 3.36e-37
Family ML domain 0.00000793
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTNIP00000020537   Gene: ENSTNIG00000017398   Transcript: ENSTNIT00000020769
Sequence length 149
Comment pep:known_by_projection chromosome:TETRAODON8:10:5309923:5311668:1 gene:ENSTNIG00000017398 transcript:ENSTNIT00000020769 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDVRSGLVVLLCLIGSTCAESVIFADCGSTSGKVAMVDIVPCPIQPCQLHKGQSYSVNVT
FNSLVESQKSKAVVYGIVAGIPVHFNIPSDDGCKSGIHCPILVQHSYSYINDLPVKSEYP
AIKLVVKWELLDDNQKDLFCIKFPVQIVS
Download sequence
Identical sequences H3DJ42
ENSTNIP00000020537 ENSTNIP00000020537 99883.ENSTNIP00000020537

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]