SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTNIP00000020541 from Tetraodon nigroviridis 76_8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTNIP00000020541
Domain Number 1 Region: 330-713
Classification Level Classification E-value
Superfamily RCC1/BLIP-II 3.05e-81
Family Regulator of chromosome condensation RCC1 0.00044
Further Details:      
 
Domain Number 2 Region: 40-325
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 1.5e-80
Family Protein kinases, catalytic subunit 0.0000079
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTNIP00000020541   Gene: ENSTNIG00000017402   Transcript: ENSTNIT00000020773
Sequence length 840
Comment pep:known_by_projection chromosome:TETRAODON8:10:5256177:5260827:-1 gene:ENSTNIG00000017402 transcript:ENSTNIT00000020773 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSMEDYERHFDSLNSELGGGSVVSERSGSGTFNGEEEKLHYIPIRILGRGAFGEATLYRR
AEDNSLVVWKEVDLKSLSEKESRDVMNEISILSMLEHDNVIAYFNHFMDNKSLFIELEYC
NGGNLYDKINQQKGQLFSEEVVVWYLYQIASAVSHIHKAGILHRDIKTLNIFLTKTDLIK
LGDYGLAKKLGSEFSMAESCVGTPYYMSPELCQGAKYNFKSDIWAMGCVLFEVLTLKRTF
DATNPLNLCVKIVQGNWTMEVNSDVYSSALIQLVYDCLHQDPANRPTAEQVLDQPFISCR
RQELEDRVALLNSAMKKPKLSTMSDTPVAVVTTRSREVYFWGGGKYTAQKMDMFKGGSSP
QHVCAGEGHFAVVTVEKELYMWANVQGGAKMVGQLGHGDQASYRQPKRVEKLQGKAIRQV
ACGADFTACVTDEDQMYMFGSDYYGCIGVEGELGTEILEPVFLEFFEERPVRQVSCGDHH
VVVLLQSGDIYSWGCGEYGRLGLECEDDFSSPMQVEVPKGAVISSVSCGSDGTFFLTESG
KVLACGNNEFNKLGLNQGISGLKTHQGFQCVFFATTLTLAKQLSRFRIHSIAPGKTHTAA
IDERGRLLTFGCNRYGQLGVKDFKKHQGVQVLVRPFGGKTLTKVSCGDGFTIAATEDNQI
FAWGNAGNGRLGMPPDKGFGSEVCPAMPRPIFGSLHHVPDLSCRGWHTIIIMEKVLNSKT
IRSNSSGLSIGCGLGQEASASFVEMDIEPASETECRDRGLGGTLEDNREECFLETPMMSA
ANQTGDSSCPLWLKKELEDAEFIPMPEDGDLPTPDQLASHSESITLPYEELKELKAAAAA
Download sequence
Identical sequences H3DJ46
ENSTNIP00000020541 99883.ENSTNIP00000020541 ENSTNIP00000020541

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]