SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTNIP00000020566 from Tetraodon nigroviridis 76_8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTNIP00000020566
Domain Number 1 Region: 450-814
Classification Level Classification E-value
Superfamily Hect, E3 ligase catalytic domain 5.23e-103
Family Hect, E3 ligase catalytic domain 0.0000035
Further Details:      
 
Domain Number 2 Region: 67-161
Classification Level Classification E-value
Superfamily E set domains 0.00000000314
Family Filamin repeat (rod domain) 0.026
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTNIP00000020566   Gene: ENSTNIG00000017425   Transcript: ENSTNIT00000020798
Sequence length 821
Comment pep:known_by_projection chromosome:TETRAODON8:10:4989240:4995015:-1 gene:ENSTNIG00000017425 transcript:ENSTNIT00000020798 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MFYVIGGITVSIIAFVFTIKFLCELAARVVSFLQNEDPGRRGDRSIYDYVRGNYLDPRSC
KVSWDWKEPQEVGQTMSFRVQLFYKNGQPFPAHRPVGLRVNITHIELALDIPVTQEVLQE
PESNVVKVAFTVRKAGRYEVAVKLGGLNVAYSPYYKIFQPGNTSQTHIVCFVSFSARVDQ
KQKPIDSLTIFSTVGFLSNGSTFVSWNSFCLSHFSQLGTMDDDSVDEFYSKSVSLNKQQC
QVLLRLTLRRTGCFRARISYKDQPLSNGEFDIIVLNENEKACVEKNVSTPGISIYFEAYL
YSSGNYSSSSWQLPASSLLAPQRRPSMGEEEDEHDSPVEGQPEKVKKPKKVYCYISPKQL
SVKEFYLKIIPWRLFTFRVCPGTKFTYCGPDPVHKYLTLVVDDGIQPPVELSCKDRNIMA
ATFIRFLHKNIGGSETFQDKVNFFQRELRHIHSKKPRTKTCLKITRHSILDSSLKATRNF
SVSDWSKNFEVVFQDEEALDWGGPRREWFELICKTLFDTSNQLFTRFSDNNQGLVHPNAD
RPAHLRLKMYEFAGRIVGKCLFESALGGAYKQLVRARFTRSFLAQIIGLRMNYKYFETDD
QEFYKTKVCFILNNDVSEMDLVFAEEKYSKSGQLEKVVELISGGAQIAVTNENKMHYLNL
LAQYRLATQVRDEVEHFLKGLNELVPENLLAIFDENELELLMCGTGDINVQDFKAHAVIV
GGSWHFREKVMKWFWAVVSSFTQEELARLLQFTTGSSQLPPGGFNTLCPSFQIIAAPTHS
TLPTAHTCFNQLCLPTYDSYEELHKMLKLAISEGSEGFGML
Download sequence
Identical sequences H3DJ71
ENSTNIP00000020566 ENSTNIP00000020566 99883.ENSTNIP00000020566

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]