SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTNIP00000020586 from Tetraodon nigroviridis 76_8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTNIP00000020586
Domain Number 1 Region: 230-407
Classification Level Classification E-value
Superfamily MIR domain 2.62e-47
Family MIR domain 0.0012
Further Details:      
 
Domain Number 2 Region: 1091-1183
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 1.11e-16
Family Galectin (animal S-lectin) 0.072
Further Details:      
 
Domain Number 3 Region: 662-814
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 0.0000000174
Family SPRY domain 0.058
Further Details:      
 
Domain Number 4 Region: 3970-4048
Classification Level Classification E-value
Superfamily EF-hand 0.000000126
Family Calmodulin-like 0.04
Further Details:      
 
Domain Number 5 Region: 96-195
Classification Level Classification E-value
Superfamily MIR domain 0.000051
Family MIR domain 0.023
Further Details:      
 
Domain Number 6 Region: 445-559
Classification Level Classification E-value
Superfamily IP3 receptor type 1 binding core, domain 2 0.0000811
Family IP3 receptor type 1 binding core, domain 2 0.017
Further Details:      
 
Weak hits

Sequence:  ENSTNIP00000020586
Domain Number - Region: 508-623,1828-1884,2005-2192,2530-2570,2607-2647,2866-2920,2964-2982,3195-3253
Classification Level Classification E-value
Superfamily ARM repeat 0.00027
Family Plakophilin 1 helical region 0.08
Further Details:      
 
Domain Number - Region: 1385-1506
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 0.00132
Family SPRY domain 0.025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTNIP00000020586   Gene: ENSTNIG00000017445   Transcript: ENSTNIT00000020818
Sequence length 4919
Comment pep:novel chromosome:TETRAODON8:10:4574944:4626840:1 gene:ENSTNIG00000017445 transcript:ENSTNIT00000020818 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
TWTRSRMPVFCPDRMMKWCSSVWPVSRRRIASFAWLLRGWATACVTWNPHPRRSMFLQTC
ASAPLCWSSRCRSGLCKRCWMLETVRTQRGALNISIWAYQYLQAAHSGGHKTLLYGHAIL
LRHSFSSMYLACLKTSRSQTDKLSFDVGLQEDSTGEACWWTIHPASKQRSEGEKVRIGDD
LILVSLSSERYLHLSISNGNIQVDASFMQTLWNVHPICSGSNIEEGYLLGGHVIRLFHGH
DEVVAIPGSDQSEEEQRIVNYETGKAGAKARSLWRLEPLRISWSGSHIRWGQPFRLRHLT
TGHYLALTEDRGLVLQDRERSDTDATAFCFRASKEKLEQSPKRDIEGMGVAEIKYGDSLC
FVMHVATGLWLSYQAPDVKSARLGPLKRRACLHTEGHMDDGLTLQRCQHEESRAARIIRN
TTLLFNRFVRDLDCLGVKNRAVVFLPVEEVLQTLNDLIAYFQLPDVELEHEERQIKLRSL
KNRQNLFKQEGMLNLVSNCIDRLNVYNSAAHFGECAGHEAGAAWKDILNLLYELLAALIR
GNRNNCTQFSNNLDWLVSKLERLESSSGILEVLHCILIESPEALNIIQRGHIKSIISLLY
KHGRNHKILDVLCSLCVCNGVAVRTNQNLICDHLLPKRDLLLQSQLVNDVQSMRPNIFLG
VSEGSAQYKKWYYELMIDQVDHFVTSEPTHLRVGWANTKGYAPYPGGGEGWGGNGVGDDL
YSFAFDGLHLWSGRVPRAVASLNQHILTSEDVVSCCLDLGAPSISFRINGQPVQGMFENF
NTDGLFFPVVSFSAGVKVRFLLGGRHGDFKFLPPSGYAPCYEALLPKEKMKVEPVKEYKR
DVGGVRDLLGTAQLLSQASFIPTPVETSQIIMPPHLEKVRDKLAENIHELWGMNKIELGW
TYGKIRDDNKRQHPCLVDFSKLPETEKNYNLQMSTETLKTLLALSCRVVQVNSNAENALK
KIKLTKNYMMSNGYKPTPLDLSDIKLTPGQEMLVDKLAENAHNVWAKDRIKQGWTYGIQQ
DLKSKRNPRLVPYVLLDERTKKSNRDSLREAIRTLIGYGYNIEPSDQEGRSGQTVERISI
DKVRFFRVERTYAVKTGKWYFEFEAVTGGDMRVGWARPGCKPDVELGTDAHAFVFDGYRG
HCLHTGSRLFGRCWHAGDVVGCMINMQDKSMIFTLNGEILITTKGSELCFTDFDAEDGFI
PVCSLGLAQVGRMNLGKDASTFKYYTMCGLQEGFEPFAVNMNREVTMWFSKRLPTFINVP
KDHNHIAVTRIDGTIDSPPCLKVSHKTFGSQNSNADMVFCRLSMPIEFHSAFKHSPIADV
NGIHEEDVLKVKHRSASGFTHNMFVDCTHEINTFMSYRYPLRSVRHSDESRRVDYSSITT
VTSHYYHSVRVFAGQDPAGVWVGWVTPDYHYYSNNFNLGKNRTVTVTLGDERGRVHEERD
SVKRSNCYMVWGGDATSAVRSNVDLEIGCLIDLATGLVTFTINGKEMSSSYQVEPNTKLF
PAVFVRPTSANLFQFELGKIKNAMPLSSAIFKSEHKNPIPQCPPRLDVQTISAVLWSRMP
NNFLKVDTARVSERHGWVVQCVEPLQMLAVHIPEENRCVDIMELSEQEDLRKFHFHTLKL
YCALCALGNTRVAHALCSHLDQSQLLYTIDNQYLSGMLREGCYNVLISIHLETAKEARLM
MKDEFIIPVTPETRSIRLFFDASKKHRPPGVGLSTSLKPRFNFAPPCFISTKQEQHLYSP
QVPLNTLKEKAISMLTEAVQGGGHHIRDPVGGCVEYQFVPILKLISTLLTMGVLASEDVH
QILLLIDPNVFRETREEGNTGATDKEGFAGAVDKAVEAGEEEAAKEAKQPLKGLLEKRLP
EPVKRQMCELLHYFCDCELKHRIEAIVSFSDNFVSKLQFNQKFRYNELMLALNMSAAVTA
KKTKEFRSPPQEQINMLLTFSTGDDCPCPSDIQEELYDFHNQLQLHCGIPMEEDEDEHHT
SIRGRLLMLVNKIKGQAHRAEEPMEKEQAAPSNLKELISQTMVSWAQECHIQDPQLVRKM
FSLLRRQYDSIGELLRAMRKTYTISASSVQDTINLLASLGQIRSLLSVRMGKEEEKLMID
GLGDIMNNKVFYQHPNLMRILGMHETVMEVMVNVLGGDKSQEIAFPKMVASCCRFLCYFC
RISRQNQKAMFDHLSYLLENSSVGLASPAMRGSTPLDVAASSVMDNNGLALALEEPDLEK
VVTYLAGCGLQSCPMLLAKGYPDIGWNPIEGERYLSFLRFAVFVNGESVEENSSVVVKLL
IRRPECFGPALRGEGGNGLLAAMKEAIKISETPALDLPGSVHGVCADVSADGDDEEEVVH
MGNAIMSFYSALIDLLGRCAPEMHLLNKGKGEALRIRAILRSLVPTEDLVGIISIPLKMP
IINKDCSVTEPDMSACFCPDHKAPMVLFLDRVYGIEDQSFLLHLLEVGFLPDLRAATSLD
TEGLCTTETALAMNRYIGSALLPLLTRCAPLFAGTEHYASLIDSTLHTIYRLSKGRSLTK
AQRDAIEECLLAVCKHLRPSMLQQLLRRLVFDVPLLTEYCKMPLRLLTNHYEQNWKYYCL
PSGWGSYGTASEDELLLTKKLFWGIFDSLSQRKYDPELFKMAMPCLSAIAGALPPDYVDA
SISTIVEKPISVDAQGNFDPKPISTASVSLPEKLEHFANKYGEHLHEKWSAEKVLLGWKY
GDSLDEKAKIHPQLRIYKSLTEKEKEIYRWPVRETLKSMLAMGWSIDRTKDGESMSQQRE
NEKLRKISQVSQVNSQVANGFNPSPTDTSNVVLSRELQGMVEVVAENYHNIWAKKKKSDL
GSRGGGPHPLLVPYDTLTAKEKARDREKAQDLFRFLQINGYSITRGLKDLEQDSSSMEKR
FAYRFLKKLLKYVDSAQEFIAHLALALEAMAASGKTDRSPHEQEIKFFAKVLLPLIDQYF
KNHCLYFLSSPNKNLSSSGYASNKEKEMVTSLFCKLAALVRHRISLFGSDSTTIVSCLHI
LAHTLDTRTVMKSGSELVRVGLRTFFENAAEDLEKTFENLKLGKFTHSRSQMKGVSQNIN
YTTVALLPILTALFEHITQHHFGADLLLEDVQVSCYRILTSLYALGTGKNIYVERQLPAL
GQCLATLAGAMPVAFLEPLLNTYNPCSVFNTKSARERAILGIPSSVEEMCPGMPRLDGLM
KDINDMAESGARYTEMPHVIEVVLPMLCNYLSYWWEKGPENQLASGGGICCTTVTSEHLS
VILGNILKILNNNLGIDEASWMKRIAVYVQPIISKARADLLRSHFLPTLEKLKKKTVKVV
SEEELLKADGRGDTQEAELLILDEFAVLCRDLYAFYPMLIRYVDNNRSRWLKEPDADSNE
LFRMVAEIFILWCKSHNFKREEQNFVVQNEINNLSFLTGDNKTKMSKSGGQDQERRHKKR
RGEFYSVQTSLIVAALKKMLPIGLNMCTPGDQELISLAKMRYLLKDTDEEVKDHIQQNLH
LREKSEDPAVRWQLNLYRDRALRFEGPPDPEKVLDRIQRISAAVFNLEQVGLYFFVEQPL
RSKKCVWQKLLSKQRKRAVVACFRMAPLYNLPRHRSINLFLQAYQRIWIETEEYSFEEKL
VQDLAKIQPKIEEEEEEEVRKQPDPLHQLILHFSHNALTECSSLEEDPLYIAYADMMAKS
CAEGEEEEEEKEKTFEEKEMEKQKMLYQQARLHDRGAAEMVLQMISASKGRLGAMVTVTL
KLGISILNGGNILVQQKMLDYLKEKRDVGFFKSLSGLMMSCSVLDLNAFERQNKAEGLGM
VTEEGSSSKVLQDDEFTKDLFRFLQLLCEGHNNDFQNFLRTQTGNTTTVNIIISTVDYLL
RLQESISDFYWYYSGKDVIDEAGQRNFSRALAVAKQVFNSLTEYIQGPCVGNQQSLAHSR
LWDAVVGFLHVFANMQMKLSQDSSQIELLKELLDLQQDMIVMMLSLLEGNVVNGTIGKQM
VDTLVESSSNVEMILKFFDMFLKLKDLTTSDSFKEYDPENKGVISKKDFQKSMENQKQYS
QSEIEFLLSCAEADENDMFNYKQFVDRFHEPAKDIGFNVAVLLTNLSEHMPHDARLSTFL
DLAESVLSYFEPYLGRIEIMGGAKRIERVYFEISESSRTQWEKPQVESKRQFIFDVVNER
GESEKMELFVNFCEDTIFEMQLASQISEPDPVERAEEDEDDGQSVQENQEEEEEQSVLLE
SSSAFTVACISMRKSLCHFRQLLTLRSLRRQYRTFRKMTVREMVQGFFSFFWIIITGFLH
FFYSLVWGFFHILWTTMFGGGFVEGAKNMKVTDILGNMPDPTQFGIHGDVLELEKIEANE
ASALADIGQMSQGDAAEAALMAELLNVQPRKEGKHGSEPGLGDVSEVVVGDAPSIASAVK
QKKAQMAAKKTASNGEHKSDLEKVDSEYGEKNDHGSSVEEKKAPKKRLGQRKEPPEAFMA
SFFASVEIYQTKILNYLARNFYNLRFLALFVAFAINFILLFYKVTGDYSDEEDLWNGRRR
TGGEEEEEGALEYFILQESTGYMAPALRCLAILHTIISFLCVVGYYYLKVPLVVFKREKE
IARKLEFAGLYITEQPSDDDIKGQWDRLVINTPSFPNNYWDKFVKRKVIKKYGDLYGAER
IAELLGLDKSALDFNPTEETVTKEASLVSWLSSIDTKYHVWKMGVVFTDNSFLYLVWYTT
MSILGHYNNFFFAAHLLDIAMGFKTLRTILSSVTHNGKQLVLTVGLLAVVVYLYTVVAFN
FFRKYNKSEDEDEPDMKCDDMMTCYLFHMYVGVRAGGGIGDEIEDPAGDPYELYRILFDI
TFFFFVIVILLAIIQGLIIDAFGELRDQQEQVKEDMETKCFICGIGNDYFDTTPHGFETH
TLQEHNLANYLFFLMYLINKDETEHTGQESYVWKMYQERCWDFFPAGDCFRKQYEDQLG
Download sequence
Identical sequences H3DJ90
ENSTNIP00000020586 ENSTNIP00000020586 99883.ENSTNIP00000020586

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]