SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTNIP00000020587 from Tetraodon nigroviridis 76_8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTNIP00000020587
Domain Number 1 Region: 206-383
Classification Level Classification E-value
Superfamily MIR domain 2.62e-47
Family MIR domain 0.0012
Further Details:      
 
Domain Number 2 Region: 1065-1157
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 1.06e-16
Family Galectin (animal S-lectin) 0.072
Further Details:      
 
Domain Number 3 Region: 638-790
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 0.0000000174
Family SPRY domain 0.058
Further Details:      
 
Domain Number 4 Region: 3950-4028
Classification Level Classification E-value
Superfamily EF-hand 0.000000126
Family Calmodulin-like 0.04
Further Details:      
 
Domain Number 5 Region: 421-535
Classification Level Classification E-value
Superfamily IP3 receptor type 1 binding core, domain 2 0.0000811
Family IP3 receptor type 1 binding core, domain 2 0.017
Further Details:      
 
Weak hits

Sequence:  ENSTNIP00000020587
Domain Number - Region: 89-171
Classification Level Classification E-value
Superfamily MIR domain 0.000123
Family MIR domain 0.027
Further Details:      
 
Domain Number - Region: 481-599,1804-1860,1981-2168,2506-2546,2583-2623,2841-2895,2939-2957,3170-3191
Classification Level Classification E-value
Superfamily ARM repeat 0.000201
Family Plakophilin 1 helical region 0.08
Further Details:      
 
Domain Number - Region: 1356-1481
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 0.000343
Family SPRY domain 0.048
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTNIP00000020587   Gene: ENSTNIG00000017445   Transcript: ENSTNIT00000020819
Sequence length 4907
Comment pep:novel chromosome:TETRAODON8:10:4574979:4626840:1 gene:ENSTNIG00000017445 transcript:ENSTNIT00000020819 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
RQDDEVVLQCVACIQKENRKFCLAAEGLGNRLCYLEPTSEAKYVPPDLCICTFVLEQSLS
VRALQEMLANSGQNSEGLQAAHSGGHKTLLYGHAILLRHSFSSMYLACLKTSRSQTDKLS
FDVGLQEDSTGEACWWTIHPASKQRSEGEKVRIGDDLILVSLSSERYLHLSISNGNIQVD
ASFMQTLWNVHPICSGSNIEEGYLLGGHVIRLFHGHDEVVAIPGSDQSEEEQRIVNYETG
KAGAKARSLWRLEPLRISWSGSHIRWGQPFRLRHLTTGHYLALTEDRGLVLQDRERSDTD
ATAFCFRASKEKLEQSPKRDIEGMGVAEIKYGDSLCFVMHVATGLWLSYQAPDVKSARLG
PLKRRACLHTEGHMDDGLTLQRCQHEESRAARIIRNTTLLFNRFVRDLDCLGVKNRAVVF
LPVEEVLQTLNDLIAYFQLPDVELEHEERQIKLRSLKNRQNLFKQEGMLNLVSNCIDRLN
VYNSAAHFGECAGHEAGAAWKDILNLLYELLAALIRGNRNNCTQFSNNLDWLVSKLERLE
SSSGILEVLHCILIESPEALNIIQRGHIKSIISLLYKHGRNHKILDVLCSLCVCNGVAVR
TNQNLICDHLLPKRDLLLQSQLVNDVQSMRPNIFLGVSEGSAQYKKWYYELMIDQVDHFV
TSEPTHLRVGWANTKGYAPYPGGGEGWGGNGVGDDLYSFAFDGLHLWSGRVPRAVASLNQ
HILTSEDVVSCCLDLGAPSISFRINGQPVQGMFENFNTDGLFFPVVSFSAGVKVRFLLGG
RHGDFKFLPPSGYAPCYEALLPKEKMKVEPVKEYKRDVGGVRDLLGTAQLLSQASFIPTP
VETSQIIMPPHLEKVRDKLAENIHELWGMNKIELGWTYGKIRDDNKRQHPCLVDFSKLPE
TEKNYNLQMSTETLKTLLALSCRVVQVNSNAENALKKIKLTKNYMMSNGYKPTPLDLSDI
KLTPGQEMLVDKLAENAHNVWAKDRIKQGWTYGIQQDLKSKRNPRLVPYVLLDERTKKSN
RDSLREAIRTLIGYGYNIEPSDQEGSQTVERISIDKVRFFRVERTYAVKTGKWYFEFEAV
TGGDMRVGWARPGCKPDVELGTDAHAFVFDGYRGHCLHTGSRLFGRCWHAGDVVGCMINM
QDKSMIFTLNGEILITTKGSELCFTDFDAEDGFIPVCSLGLAQVGRMNLGKDASTFKYYT
MCGLQEGFEPFAVNMNREVTMWFSKRLPTFINVPKDHNHIAVTRIDGTIDSPPCLKVSHK
TFGSQNSNADMVFCRLSMPIEFHSAFKHSPIADVNGIHEEDVLKVKHRSASGFTHNMFVD
CTHEINTFMSYRYPLRSVRHSDESRRVDYSSITTVTSHYYHSVRVFAGQDPAGVWVGWVT
PDYHYYSNNFNLGKNRTVTVTLGDERGRVHERDSVKRSNCYMVWGGDATSAHASSRSNVD
LEIGCLIDLATGLVTFTINGKEMSSSYQVEPNTKLFPAVFVRPTSANLFQFELGKIKNAM
PLSSAIFKSEHKNPIPQCPPRLDVQTISAVLWSRMPNNFLKVDTARVSERHGWVVQCVEP
LQMLAVHIPEENRCVDIMELSEQEDLRKFHFHTLKLYCALCALGNTRVAHALCSHLDQSQ
LLYTIDNQYLSGMLREGCYNVLISIHLETAKEARLMMKDEFIIPVTPETRSIRLFFDASK
KHRPPGVGLSTSLKPRFNFAPPCFISTKQEQHLYSPQVPLNTLKEKAISMLTEAVQGGGH
HIRDPVGGCVEYQFVPILKLISTLLTMGVLASEDVHQILLLIDPNVFRETREEGNTGATD
KEGFAGAVDKAVEAGEEEAAKEAKQPLKGLLEKRLPEPVKRQMCELLHYFCDCELKHRIE
AIVSFSDNFVSKLQFNQKFRYNELMLALNMSAAVTAKKTKEFRSPPQEQINMLLTFSTGD
DCPCPSDIQEELYDFHNQLQLHCGIPMEEDEDEHHTSIRGRLLMLVNKIKGQAHRAEEPM
EKEQAAPSNLKELISQTMVSWAQECHIQDPQLVRKMFSLLRRQYDSIGELLRAMRKTYTI
SASSVQDTINLLASLGQIRSLLSVRMGKEEEKLMIDGLGDIMNNKVFYQHPNLMRILGMH
ETVMEVMVNVLGGDKSQEIAFPKMVASCCRFLCYFCRISRQNQKAMFDHLSYLLENSSVG
LASPAMRGSTPLDVAASSVMDNNGLALALEEPDLEKVVTYLAGCGLQSCPMLLAKGYPDI
GWNPIEGERYLSFLRFAVFVNGESVEENSSVVVKLLIRRPECFGPALRGEGGNGLLAAMK
EAIKISETPALDLPGSVHGVCADVSADGDDEEEVVHMGNAIMSFYSALIDLLGRCAPEMH
LLNKGKGEALRIRAILRSLVPTEDLVGIISIPLKMPIINKDCSVTEPDMSACFCPDHKAP
MVLFLDRVYGIEDQSFLLHLLEVGFLPDLRAATSLDTEGLCTTETALAMNRYIGSALLPL
LTRCAPLFAGTEHYASLIDSTLHTIYRLSKGRSLTKAQRDAIEECLLAVCKHLRPSMLQQ
LLRRLVFDVPLLTEYCKMPLRLLTNHYEQNWKYYCLPSGWGSYGTASEDELLLTKKLFWG
IFDSLSQRKYDPELFKMAMPCLSAIAGALPPDYVDASISTIVEKPISVDAQGNFDPKPIS
TASVSLPEKLEHFANKYGEHLHEKWSAEKVLLGWKYGDSLDEKAKIHPQLRIYKSLTEKE
KEIYRWPVRETLKSMLAMGWSIDRTKDGESMSQQRENEKLRKISQVSQVNSQANGFNPSP
TDTSNVVLSRELQGMVEVVAENYHNIWAKKKKSDLGSRGGGPHPLLVPYDTLTAKEKARD
REKAQDLFRFLQINGYSITRGLKDLEQDSSSMEKRFAYRFLKKLLKYVDSAQEFIAHLAL
ALEAMAASGKTDRSPHEQEIKFFAKVLLPLIDQYFKNHCLYFLSSPNKNLSSSGYASNKE
KEMVTSLFCKLAALVRHRISLFGSDSTTIVSCLHILAHTLDTRTVMKSGSELVRVGLRTF
FENAAEDLEKTFENLKLGKFTHSRSQMKGVSQNINYTTVALLPILTALFEHITQHHFGAD
LLLEDVQVSCYRILTSLYALGTGKNIYVERQLPALGQCLATLAGAMPVAFLEPLLNTYNP
CSVFNTKSARERAILGIPSSVEEMCPGMPRLDGLMKDINDMAESGARYTEMPHVIEVVLP
MLCNYLSYWWEKGPENQLASGGGICCTTVTSEHLSVILGNILKILNNNLGIDEASWMKRI
AVYVQPIISKARADLLRSHFLPTLEKLKKKTVKVVSEEELLKADGRGDTQEAELLILDEF
AVLCRDLYAFYPMLIRYVDNNRSRWLKEPDADSNELFRMVAEIFILWCKSHNFKREEQNF
VVQNEINNLSFLTGDNKTKMSKVGFKQSGGQDQERRHKKRRGEFYSVQTSLIVAALKKML
PIGLNMCTPGDQELISLAKMRYLLKDTDEEVKDHIQQNLHLREKSEDPAVRWQLNLYRDR
ALRFEGPPDPEKVLDRIQRISAAVFNLEQVEQPLRSKKCVWQKLLSKQRKRAVVACFRMA
PLYNLPRHRSINLFLQAYQRIWIETEEYSFEEKLVQDLAKIQPKIEEEEEEEVRKQPDPL
HQLILHFSHNALTECSSLEEDPLYIAYADMMAKSCAEGEEEEEEKEKTFEEKEMEKQKML
YQQARLHDRGAAEMVLQMISASKGRLGAMVTVTLKLGISILNGGNILVQQKMLDYLKEKR
DVGFFKSLSGLMMSCSVLDLNAFERQNKAEGLGMVTEEGSILSQSSGSKVLQDDEFTKDL
FRFLQLLCEGHNNDFQNFLRTQTGNTTTVNIIISTVDYLLRLQESISDFYWYYSGKDVID
EAGQRNFSRALAVAKQVFNSLTEYIQGPCVGNQQSLAHSRLWDAVVGFLHVFANMQMKLS
QDSSQIELLKELLDLQQDMIVMMLSLLEGNVVNGTIGKQMVDTLVESSSNVEMILKFFDM
FLKLKDLTTSDSFKEYDPENKGVISKKDFQKSMENQKQYSQSEIEFLLSCAEADENDMFN
YKQFVDRFHEPAKDIGFNVAVLLTNLSEHMPHDARLSTFLDLAESVLSYFEPYLGRIEIM
GGAKRIERVYFEISESSRTQWEKPQVESKRQFIFDVVNERGESEKMELFVNFCEDTIFEM
QLASQISEPDPVERAEEDEDDGQSVQENQEEEEEQSVLLESSSAFTVACISMRKSLCHFR
QLLTLRSLRRQYRTFRKMTVREMVQGFFSFFWIIITGFLHFFYSLVWGFFHILWTTMFGG
GFVEGAKNMKVTDILGNMPDPTQFGIHGDVLELEKIEANEASALADIGQMSQGDAAEAAL
MAELLNVQPRKEGKHGSEPGLGDVSEVVVGDAPSIASAVKQKKAQTDGQQTCVSPPQKYN
CCCSSEYGEKNDHVRTKDEAPQGSSVEEKKAPKKRLGQRKEPPEAFMASFFASVEIYQTK
ILNYLARNFYNLRFLALFVAFAINFILLFYKVTGDYSDEEDLWNGRRRTGGEEEEEGALE
YFILQESTGYMAPALRCLAILHTIISFLCVVGYYYLKVPLVVFKREKEIARKLEFAGLYI
TEQPSDDDIKGQWDRLVINTPSFPNNYWDKFVKRKVIKKYGDLYGAERIAELLGLDKSAL
DFNPTEETVTKEASLVSWLSSIDTKYHVWKMGVVFTDNSFLYLVWYTTMSILGHYNNFFF
AAHLLDIAMGFKTLRTILSSVTHNGKQLVLTVGLLAVVVYLYTVVAFNFFRKYNKSEDED
EPDMKCDDMMTCYLFHMYVGVRAGGGIGDEIEDPAGDPYELYRILFDITFFFFVIVILLA
IIQGLIIDAFGELRDQQEQVKEDMETKCFICGIGNDYFDTTPHGFETHTLQEHNLANYLF
FLMYLINKDETEHTGQESYVWKMYQERCWDFFPAGDCFRKQYEDQLG
Download sequence
Identical sequences H3DJ91
ENSTNIP00000020587

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]