SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTNIP00000020643 from Tetraodon nigroviridis 76_8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTNIP00000020643
Domain Number 1 Region: 7-377
Classification Level Classification E-value
Superfamily Ankyrin repeat 6.95e-62
Family Ankyrin repeat 0.000039
Further Details:      
 
Domain Number 2 Region: 452-507
Classification Level Classification E-value
Superfamily SOCS box-like 0.000000000288
Family SOCS box-like 0.0027
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTNIP00000020643   Gene: ENSTNIG00000017499   Transcript: ENSTNIT00000020876
Sequence length 516
Comment pep:known_by_projection chromosome:TETRAODON8:Un_random:14233722:14237061:1 gene:ENSTNIG00000017499 transcript:ENSTNIT00000020876 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
VRQREKLRHADSRGWSPLHEAAVQTNHNVLELVFTASGPESVQGRTRLGQTPLFLAAERG
LMENVSFLLQHGADPDSLDQVQDSPLIAAIRSDCKDLVQLLLLQGAKVDQEVCHGRRPLH
EASRLGRAALVTLLLEAGAHPDPRSHYGLPLALAAQGGHHQVVEALLDKGADVQSQAHDD
ASGLYEASASGDPAVIGLLLERGADANVAKNTGHMPIHRVAHRGHLEALKLLIPVTCKAE
VSESGMSPLHSAAAGGHSQCLKALLDAGYDPNYMLQPWVRRSYDDERKSALFFAVSNNDV
AATELLLEAGAMTNQDPVKCLQVALRLGNYELINLLLRFGANVNYYCRVNTTHFPSALQY
ALKDEVVLRMLCNYGYDVQRCFDCPYGNSAHIPEGYEGWSNSVIKDTLFCEVITVSWLKH
LSGQVVCILLDYVDHVTLCSKLKGAVMEHQQWPHICWLQENARRLKHLCRLRIRRCLGRL
RLRSPVFMSFLPLPRRLKDYILYREYDMHDQKSGIS
Download sequence
Identical sequences H3DJE7
ENSTNIP00000020643 99883.ENSTNIP00000020643 ENSTNIP00000020643

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]