SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTNIP00000020648 from Tetraodon nigroviridis 76_8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTNIP00000020648
Domain Number 1 Region: 213-345
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 1.4e-23
Family Pentraxin (pentaxin) 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTNIP00000020648   Gene: ENSTNIG00000017504   Transcript: ENSTNIT00000020881
Sequence length 345
Comment pep:known_by_projection chromosome:TETRAODON8:Un_random:7048312:7050092:1 gene:ENSTNIG00000017504 transcript:ENSTNIT00000020881 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MQAAKSAVSWRLFLFLCLLSESSSQDFGGQTQFICTSVPKNMDICAATLQNSVPGDDLKS
TVIQLRETVLQQKETIMNQKETIRELTSKLARCESQRRKEAGTKNTMGDVSRGPADTLTQ
LSQTLQSLKQRLENLEQISRSNKSAQANSKDLLQSRIDDLEKQVLSQRSNEQHRGGEAGA
ASKRLECESTLTSLHQRITDLEKGQRENRPLDKFQLTFPMRTNYMYAKVKKSLPEMYALT
VCMWLKSNASPGVGTPFSYAVPGQANELVLIEWGNSPMEILINDKVAKLPFLINDGKWHH
ICVTWTTRDGVWEAFQDGVKRGSGENLAPYHPIKPQGLLILGQEQ
Download sequence
Identical sequences H3DJF2
ENSTNIP00000020648 99883.ENSTNIP00000020648 ENSTNIP00000020648

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]