SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTNIP00000020672 from Tetraodon nigroviridis 76_8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTNIP00000020672
Domain Number 1 Region: 116-233
Classification Level Classification E-value
Superfamily C-type lectin-like 3.71e-38
Family Link domain 0.0034
Further Details:      
 
Domain Number 2 Region: 638-775
Classification Level Classification E-value
Superfamily C-type lectin-like 3.85e-38
Family C-type lectin domain 0.00000753
Further Details:      
 
Domain Number 3 Region: 233-334
Classification Level Classification E-value
Superfamily C-type lectin-like 2.84e-30
Family Link domain 0.0086
Further Details:      
 
Domain Number 4 Region: 8-121
Classification Level Classification E-value
Superfamily Immunoglobulin 0.0000000000121
Family V set domains (antibody variable domain-like) 0.047
Further Details:      
 
Domain Number 5 Region: 784-851
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0000000000121
Family Complement control module/SCR domain 0.0021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTNIP00000020672   Gene: ENSTNIG00000017528   Transcript: ENSTNIT00000020905
Sequence length 884
Comment pep:known_by_projection chromosome:TETRAODON8:21_random:1857147:1870064:-1 gene:ENSTNIG00000017528 transcript:ENSTNIT00000020905 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
FLVKIPHSGPLFSSLGGSISIPCSVLLPSSPPASLSSSVEPRIKWSVVSGGVETQILVAK
GDRIKVNEAYRNRSVWLNYTSSPYDSTLWLGELRSSDSGHYRCEVLNGLEDSSDVVELRV
KGVVFHYRDASGRYEFTFPQAQGACWAIGAQIASPEQLLAAFYDGYEQCDAGWLADQSVR
YYPIQVPRHGCYGDMDGQPGVRNYGTMNPDEIFDVYCYIEEMHGVVFLDPVPQKLSFDDA
QAYCRSVGAELASTAQLYLAWREGLDHCSPGWLSDGSVRYPITSPRDRCGGPRAGVRTLY
RFRNQTGFPDPHSLHDVYCFKGDGNTDFFSVAPKASDHENSGQDVVILTETDQELRLNQH
AEQVELKAQQVVESFPFYHSSSEESDTEGSTKRVKSTFKPVEHTNLEDKPTNESQEIGTS
RLNYSREQDNEENGRDLEESLWKVNLDSKVTAKLEETTVKAPVQTSPSSRASVEDVEMIT
QTAQTTESSRKNRLAPLDGSGDAFQDLPRHLHNPPSPSSPRIKASAASSSRLTSTAHWSR
GSWSPTTPTPKNDHPTTEPQKVTPIIPPVDQEPETCNKSHFPHLHQQVKSSILMNGELSE
QKILNSVFRSKSTLPVVSDLCADEPCLNGGTCTDHQGQITCLCLPTYTGRLCQTDSERCQ
PGWDKFQGSCYRHFGQRLSWEVAEQHCRMQGAHLVSIMSPEEQSYINSNYKEYQWTGLND
KTIEDDFRWSDGNPLLYENWYRGQPDSYFLSGEDCVVMVWHDGGRWSDVPCNYHLATCKK
ATSSCGPPPRVRNASIFGKVRRSYETNAVVRYRCALGYQQRLNPLIRCLSKGRWERPQIL
CIPVLIHPPPPHHPQPVTPRSRGQRQVKRGRSLRTPPGVPLSSE
Download sequence
Identical sequences H3DJH6
ENSTNIP00000020672 ENSTNIP00000020672 99883.ENSTNIP00000020672

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]