SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTNIP00000020678 from Tetraodon nigroviridis 76_8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTNIP00000020678
Domain Number 1 Region: 234-421
Classification Level Classification E-value
Superfamily Ankyrin repeat 7.77e-24
Family Ankyrin repeat 0.001
Further Details:      
 
Domain Number 2 Region: 519-628
Classification Level Classification E-value
Superfamily Second domain of FERM 0.0000000000000183
Family Second domain of FERM 0.0028
Further Details:      
 
Weak hits

Sequence:  ENSTNIP00000020678
Domain Number - Region: 421-510
Classification Level Classification E-value
Superfamily Ubiquitin-like 0.0672
Family Ras-binding domain, RBD 0.039
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTNIP00000020678   Gene: ENSTNIG00000017534   Transcript: ENSTNIT00000020911
Sequence length 742
Comment pep:known_by_projection chromosome:TETRAODON8:21_random:1902851:1906499:1 gene:ENSTNIG00000017534 transcript:ENSTNIT00000020911 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGNEDSLEDVFVAVIRPKSQVSLSSKEYRAKAYEILLIEVPLEGKEKKRKKVLLATKIQS
GGDKSKSILDYVDTTVRPISNNQGFIGKRVVYMRKFLLEGENEGKEASFFVVPVGVKDNS
KPVYSAGSPSFYCFQDIMRVCSETSVHFCPITSKMLLALDKWLAEQHTVPHAIPALFRPA
PVERVKTNVFNPAYSSEGKLNDEGLLMGYNLLEIKTKMMSLEKADMCITNPLYGSDLQYT
NRVDKVIINPYFGLGAPDYTKIQIPKRDKWQHNPNCVNEDKDRQWVDDFPLHRSACEGDT
ELLSKLLDSAFSVTQMDSDQWAPIHYACWHGKVEATKLLLEKGNCNPNLLNGQLSSPLHF
AAGGGHAEIVQLLLQHPEIDRHIEDQQKRTPQQVCEENKQNDWEETVKLLQQAGSKPYEK
VRIYRMDGSYRSVELKHGNNTTVQQIMEGMRLSQDTQQYFTIWICSENLHLQLKPYHKPL
QHLRIWTEIVTDLTVLDPQRETPQLFLRRDVRLPLDVEKKVEDPLAILILFDEARHCLLK
GFFPAPDSKLITLASLLLQIIYGNYESKKHKQGFLNEENLKSIVPISKVKSKAYHWTSRI
LHEYKALSTSEGVSKEMHHLQRLFLQNCWDIPTYGAAFFTGQVFTKASASNHKVLRVYVG
VNTKGLHLMNMETKVLLISLEYGTFMWQLGHADQYVQIHSGNNKMNFIVHTKQAGLIVKL
LMKLSGQMTPNDKGVTDKYTYG
Download sequence
Identical sequences H3DJI2
ENSTNIP00000020678 99883.ENSTNIP00000020678 ENSTNIP00000020678

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]