SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTNIP00000020764 from Tetraodon nigroviridis 76_8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTNIP00000020764
Domain Number 1 Region: 5-182
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 3.17e-23
Family Clostridium neurotoxins, the second last domain 0.031
Further Details:      
 
Domain Number 2 Region: 364-504,537-557
Classification Level Classification E-value
Superfamily Metalloproteases ("zincins"), catalytic domain 0.0000000000000496
Family Astacin 0.082
Further Details:      
 
Domain Number 3 Region: 1197-1259
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000000973
Family Complement control module/SCR domain 0.0037
Further Details:      
 
Domain Number 4 Region: 1255-1326
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.000000104
Family Complement control module/SCR domain 0.0042
Further Details:      
 
Domain Number 5 Region: 1320-1384
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000106
Family Complement control module/SCR domain 0.0072
Further Details:      
 
Weak hits

Sequence:  ENSTNIP00000020764
Domain Number - Region: 1128-1197
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.000514
Family Complement control module/SCR domain 0.0039
Further Details:      
 
Domain Number - Region: 323-382
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.022
Family Growth factor receptor domain 0.0079
Further Details:      
 
Domain Number - Region: 789-858
Classification Level Classification E-value
Superfamily Fibronectin type III 0.0665
Family Fibronectin type III 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTNIP00000020764   Gene: ENSTNIG00000017617   Transcript: ENSTNIT00000020997
Sequence length 1541
Comment pep:known_by_projection chromosome:TETRAODON8:Un_random:20244169:20280000:1 gene:ENSTNIG00000017617 transcript:ENSTNIT00000020997 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
PSSWMTALYFGGGREQLKLDPAAGLELPRDKFSLELWLKPEGGQSNPAVVAGVFDHCSHS
LSDKGWSVGIRTFGPSSTKDARFYFTLRTDRASKATTVYSQRRYRAASWTHLVATYDGLH
MTLYADGAKVAESSLQTGNLYSPFMKTCRNFFLGSGQLDQSHSFRGLIGGVVLWNYERSH
MELLKGPLQTDPNVPVLAMWADFLKVEQIWTPNKAGLHPAVVPTPVPEPEVVSPYLPPPC
GLTPCDNTDIISGYNNNWQLCAHKRVRYRIVNLCNDDGGSPTVSEGQIQLQHRALTDAFW
PYNITFDLSVHTERNTSLRQQFILNCQIEKIGNRRCDPECDHPRTGHDGGDCLRQLYAWK
RQDGVCNMECNSIQYDYDDGDCCDPEVTNVVKTCFDPESPDRAYMSVKELKEELHLSGAD
TLNVFFASNSVREELAGAATWPWAKEALTHQGGMVLNPAYFGTVSHQNTMIHEMGHILGL
YHVFKGVSERESCEDPCRETTPSMETGDLCADTAPMPKSKACQDPGAVNDTCGLATYRGT
PYSNYMSYTDDNCTNHFTPNQMARMHCYLDLVYQNWMADGPPASIPLAPAVSGHSLDSVL
IHWLPPVRGPLYPSSSAPLLSCGDCSLDGVFHQYAYEAASPRVCDTSGYWTPDEAVGPPD
VEQPCEPSLQAWSPELSLYDTNVTSPCPDTEGCTLTLTFLHPVVPHALTLWVTYISSTNL
LDNPAVADIELIRDGAQSIHLGPQHVFCDMPLTMRLDTGNTTISAVKLCTFDERLEIDAI
MLSSGPGSPLCSGCSPLRYRVERQPAFTRAPEPQTHRTFTDSSVQQGVKYQYVIQVEADG
LLNRFSPPLVYTHGQPYCGDGLVQGPEDCDDGNLLDGDGCSKKCLMETGFNCKGAPSQCY
VFEGDGVCEDFERSSSIQDCGYFTPLGYSDQWASTAAASHQHPERCPAHAVTGEPSLTKL
CRFQHLEVSDRSPSDAWFPCTAQPDTNNDLEYSFWLKVGFVQPGVAASVLVYLASDGSWS
GEQCRRTVTIFLSDTSGTNHSLGTHDLSCHRNPLVVNVNHDLSRPFFLTAGVILRFSSPS
VAVRGVALRTSCHFSTFALTGCASESFSFSSSSCISCLHQQPCQTDDCSPPQLQHATVRC
SGQGEESRCSVQCHHGYSIASRSGRTAPPRQRQTHLKCLHGSWDQTVSCQPTDCGLPDPS
YVYHAVFSCPQGTTFGKQCSFTCRPPAILQGDSDRLVCLEDGLWSFPEAYCKIECAEVPS
IPSARLLTADCLTSGHDIGSVCRYKCNPGFYVTGSLKNKTPRKHFRLACLESGRWEEASC
EAVSCPALPDVFQRMYTCTNSLYYDTRCTLHCQDPAESVKAGAHLMEIRCNKDGKWTAEF
SMCSGIQGSCPPPPPDLNSVEYSCEQGTDVGSQCFPTCLVTLDMALWDPVVLPNGTTAAA
LKHWMLPSKVSSIVCTGMMKWFPDPQQIHCIQSCEPFGGDGWCDTLNRAYCQYDGGDCCP
STLSTRKVIQFGVDCDHDECTCRDPDAEENKSKQTQDAGGG
Download sequence
Identical sequences H3DJR8
ENSTNIP00000003910 ENSTNIP00000020764 99883.ENSTNIP00000020764

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]