SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTNIP00000020765 from Tetraodon nigroviridis 76_8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTNIP00000020765
Domain Number 1 Region: 1011-1048,1084-1128
Classification Level Classification E-value
Superfamily Fibronectin type III 0.00000436
Family Fibronectin type III 0.0072
Further Details:      
 
Weak hits

Sequence:  ENSTNIP00000020765
Domain Number - Region: 580-622
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0698
Family Merozoite surface protein 1 (MSP-1) 0.083
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTNIP00000020765   Gene: ENSTNIG00000017618   Transcript: ENSTNIT00000020998
Sequence length 1274
Comment pep:known_by_projection chromosome:TETRAODON8:Un_random:20282359:20471387:-1 gene:ENSTNIG00000017618 transcript:ENSTNIT00000020998 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
GDEDPGEDSECKMKSVTVSALPFLRENDLSIMHSPSASEPKLLFSVRNDFPGDVVVVDDL
ENTELPFFILVEISGNSEDIPLVRWRQQWLENGTLLFHIHHQDGGLTLPDPTEDPANDSA
KEELRILHISVMGGMIALLLSILCLVLILYTRRRWCKRRRIPQPQKSASAEAANEIHYIP
SVLMGGQARESLRNSRGQGPNSGTLSIRETPILDGYEYDITDLRHHLQRECMNGGEEFAS
QVNRTLDSLQGCNDKNNIDLTTVSDNTKLALMNKCKDIIATSPIDSNHQQNTLLPHNTST
SQRKRLSSNTRTGSTFLNPDGDSGTEADSEPQMAFYTDPNRSRRRSRAGSPRSPISKTTL
TLISVISCVIGLVCSSHLSCSLSVRVVLHVPEHLIADGSRFILLQGSQLDASDWLNPAQI
LLYHQQNASGPWLSELCGRRLLDPCEHQCDPETGECLCLDGYMKDPVHKHLCIRSEWGPN
QGPWPYTIFQRGFDLVMGEQPSDRIFRFTYTLGEGMWLPLSKSVVLVGATTTDGKLRKSL
SCETDFYFLTCSFGREELMISSSFDSLEVLLDSFGPVRDCAKDNGGCSRNFRCISDRKLD
SSGCVCPPGLSPMKDGTGCYDHRIGIDCSDGFNGGCEQLCLQQLAPLEDDPTLYNIQMFC
GCIEDYKRGPDGRSCLPLSEACTEGVDCLEAVDIPANQTVFGDLFYGYNNHTKESTSGQI
LRATFRQKNFARGIEQQLPDGMVVASVPTEVQCHEELSDPVPDPEYLTGMVNYSEVSGYP
LVQHWSLRSVLYHVKLNQWVLSQAFSSAVHSLDGATQRSDFVSILRDFGNHFVQEAVYGF
QESCTIWYPNKQVQRQLWLEYQDISKGNSPSEESEERDKEPRTLTYPAYITSLLDTGAKR
MAAGVRMECSSQGQCPRSCHLCHMSPRAAQGRQQSEPVLLRITKATPIYELVSNNETYQA
LQEAMMSMLWCSGKGDVIDDWCRCDSAAFGADGLPTCAPLPQPMLKLSYTYEPSSSLVIM
EWNHTEPPIGVKIVDYLISQEKVTERSDHSKVETAETLLSFVDDILSGARSPCVMLGDVP
GLLSSSISMIVRCLEPDTTYMFRLWAVDNTGRRSSPTEVTIKTPCPTVDDVKAQEIADKI
YNLFNGYTSGKEQQTAYNTLMDLGAPTLHRVLYHYNQRYESFGEFTWRCEDELGPRKASL
ILSQLEELSPWCKGLLQEPKIGLRRMSLKFLSCRYTDTKVLGIGWLGLGPDVHKACDLQT
LTVMYNDYGEPKEL
Download sequence
Identical sequences H3DJR9
ENSTNIP00000020765

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]