SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTNIP00000020780 from Tetraodon nigroviridis 76_8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTNIP00000020780
Domain Number 1 Region: 14-276
Classification Level Classification E-value
Superfamily Ankyrin repeat 3.52e-63
Family Ankyrin repeat 0.00005
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTNIP00000020780   Gene: ENSTNIG00000017632   Transcript: ENSTNIT00000021013
Sequence length 300
Comment pep:known_by_projection chromosome:TETRAODON8:1:12126134:12129348:1 gene:ENSTNIG00000017632 transcript:ENSTNIT00000021013 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
VCTMSFKKETPLANAVFWAVRKGNLALLQLLLNSGRVDADCRDSCGTTALMVASYNGHCE
CARELIMQGADINYQRETGSTALFFASQQGHNEVVKLLFDFGASTEFRTKDGGTALTAAS
QHGHSKVVDTLLKNGANVHDQLNDGATALFLAAQEGHVNVMRHLLSSGAKVNQARKDGTA
PLWMAAQMGHSETARVLLLRGAERDAERHDGSTALFKAAFKGHNSVVEELLKFSPSLGLL
KNGSSALHAAMSGNIKTVLLLLGADADPTLVNQSNELPADLTKSDHILKVLRPKLLNVDS
Download sequence
Identical sequences H3DJT4
99883.ENSTNIP00000020780 ENSTNIP00000020780 ENSTNIP00000020780

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]