SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTNIP00000020831 from Tetraodon nigroviridis 76_8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTNIP00000020831
Domain Number 1 Region: 124-217
Classification Level Classification E-value
Superfamily TATA-box binding protein-like 1.57e-33
Family TATA-box binding protein (TBP), C-terminal domain 0.0000029
Further Details:      
 
Domain Number 2 Region: 213-300
Classification Level Classification E-value
Superfamily TATA-box binding protein-like 4.55e-30
Family TATA-box binding protein (TBP), C-terminal domain 0.00000669
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTNIP00000020831   Gene: ENSTNIG00000017681   Transcript: ENSTNIT00000021064
Sequence length 302
Comment pep:known_by_projection chromosome:TETRAODON8:5:3657252:3659453:1 gene:ENSTNIG00000017681 transcript:ENSTNIT00000021064 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDQNNSIPGFQGLASPQGAMTPGMPIFSPMMPYGSGLTPQPVQNTNSLSILEEQQRQQQQ
QQQQQQHLGIPGTSGTTPQLFHSQAVTGTTTTALPGNTPPLYNAPLTPMTPITPATPASE
SSGIVPQLQNIVSTVNLGCKLDLKTIALRARNAEYNPKRFAAVIMRIREPRTTALIFSSG
KMVCTGAKSEEQSRLAARKYARVVQKLGFPAKFLDFKIQNMVGSCDVRFPIRLEGLVLTH
QQFSSYEPELFPGLIYRMIKPRIVLLIFVSGKVVLTGAKVRAEIYEAFENIYPILKGFRK
TT
Download sequence
Identical sequences H3DJY5
ENSTNIP00000020831

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]