SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTNIP00000020862 from Tetraodon nigroviridis 76_8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTNIP00000020862
Domain Number 1 Region: 1038-1230
Classification Level Classification E-value
Superfamily Fibronectin type III 2.05e-28
Family Fibronectin type III 0.0025
Further Details:      
 
Domain Number 2 Region: 1229-1275,1310-1446
Classification Level Classification E-value
Superfamily Fibronectin type III 3.87e-27
Family Fibronectin type III 0.0031
Further Details:      
 
Domain Number 3 Region: 102-262
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 5.68e-17
Family Trypanosoma sialidase, C-terminal domain 0.064
Further Details:      
 
Domain Number 4 Region: 622-672
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000363
Family Laminin-type module 0.0056
Further Details:      
 
Domain Number 5 Region: 830-873
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000921
Family Laminin-type module 0.01
Further Details:      
 
Domain Number 6 Region: 675-726
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000173
Family Laminin-type module 0.0051
Further Details:      
 
Domain Number 7 Region: 729-773
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000335
Family Laminin-type module 0.01
Further Details:      
 
Domain Number 8 Region: 778-827
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000126
Family Laminin-type module 0.0087
Further Details:      
 
Domain Number 9 Region: 556-624
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000022
Family Laminin-type module 0.021
Further Details:      
 
Domain Number 10 Region: 987-1035
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000128
Family Laminin-type module 0.018
Further Details:      
 
Domain Number 11 Region: 886-932
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000232
Family Laminin-type module 0.01
Further Details:      
 
Domain Number 12 Region: 499-553
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000879
Family EGF-type module 0.039
Further Details:      
 
Weak hits

Sequence:  ENSTNIP00000020862
Domain Number - Region: 936-979
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000391
Family Laminin-type module 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTNIP00000020862   Gene: ENSTNIG00000017712   Transcript: ENSTNIT00000021095
Sequence length 1462
Comment pep:known_by_projection chromosome:TETRAODON8:5:3208476:3239635:1 gene:ENSTNIG00000017712 transcript:ENSTNIT00000021095 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
SSSQGNFPQMENIAAYKPISASPSRSTCGLPERSSYCQSAYSHSELGKCYQAFCVQDCPY
RSSTPPFAPLLLRSHRSNCVTEDPNDTRPGTQTENASGSGSDPSGCLVSPPSQKLGVMGS
LTLAVWIKPKSSGEMMVLEKSTAEKLLFSVTVSDQALTLRYGQNRLAVSFRTEGRLPLDS
WTHLVLQVHDRHVSLFLDGLEEDGTPFDTQVLSTRMSDRSEDGAAMWVGLSSNGSNQFIG
WMRDFRFYPATLSNREIMEVYSGVLPKLHAQSECRCPQTHPRVHPLIERYCISNGVEDTT
NDRVLRLNLNAHPLSYMNDQDMGTSWISKIMSPQELDEGVTITLDLANGQYQVFHVIVQF
GGLLPETVLIQRRKLDLADLDSDARSEQPWLDWQYMARNCSVFEMQNNGPLLKPDSVNCM
QLPKDVPFSGGNITFSLLTPEPNPRPGYNDFYNNPALQKMVHATWVRIHLSGQYHTRETT
VSLRHRYYAIKEITISGRCECHGHANHCDTSGTAYRCLCAPESHTEGDNCQRCAALYNDK
PFRSGDQLQPMNCRPCQCHGHALSCHYDVTADDQPDEHYRGGGGICDNCSNNTTGKNCEL
CIRGFFRLVGSDPTSPNVCQPCKCNIAGTVNGSVICAQVGGQCQCKVAVTGRQCENCLPG
WYGLKASESNGCVRCNCSEVGAINTSAGAPSCDQKTGQCQCKAQVTGLSCDRCEFGYWNL
SHPDGCIPCDCDPLGSLSPFCEPEGGQCECKAGVGGRRCDSCGTGSYGLKLEGSCSSCNC
SNEGALPGTNCDPHSGQCVCKEHVEGHSCDTCHRGYHTLERRNSLGCLPCVCDIYGTVPG
GVCDEWTGQCPCREGVEGSQCTNCAPNYYNRSGNSREERFWSCVPCVCDPKGTVPWSVCD
TTTGQCVCIPTHHGQDCSGCRTGFYLSPDLNVCVECLCHPMGASQRGCDSQTGQCVCVHP
SVGGQHCDQCHDMFYGFNPGLGRCQPCTCDLMGSVNGSCHPDSGVCSCKLLVAGDKCDQC
QTGASHFDPGNHLGCSKAPSQQPAPLGFAVSSSAIKLSWHPPDSPNSNRLSYTLIRDGQS
VHYIQSSYPFSPESFEDSGLFPYTNYSYRLITANVAGETTSTFALFQTLAAPPDADQLHL
MLVGHTRPTSASFNWSSPPSDKGPVERFILSTSESFSGAQPVSHFSGLSTQAVATGLKPF
TQYSVVLEACSSGGCTSTPPLSFLTASAPPQNQPPPTVSALGPHSLQASWEPPRQPNGLI
RRYEVFLRGPIKSQNLSVLPDERRVFFSSDWLEAGVSLEDQPTNKSAFLPPQNSTIVTGL
QAFSTYQMRVVSINEAGSATSAWTTARTMEGVPEWIAPPEVSALSSTSLRVEWNSSEGHG
VVARGQVVEYQVSLLTEQTNNPHAPPLISQVVHRMKPSAQSVYVVEGLKPYNMYNFTVTV
CTKTGCITSLPGAGRTLPAGKN
Download sequence
Identical sequences H3DK16
99883.ENSTNIP00000020862 ENSTNIP00000020862 ENSTNIP00000020862

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]