SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTNIP00000020926 from Tetraodon nigroviridis 76_8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTNIP00000020926
Domain Number 1 Region: 12-402
Classification Level Classification E-value
Superfamily Ankyrin repeat 4.58e-96
Family Ankyrin repeat 0.00000352
Further Details:      
 
Domain Number 2 Region: 636-991
Classification Level Classification E-value
Superfamily Ankyrin repeat 2.39e-70
Family Ankyrin repeat 0.0000149
Further Details:      
 
Domain Number 3 Region: 419-656
Classification Level Classification E-value
Superfamily Ankyrin repeat 2.7e-53
Family Ankyrin repeat 0.00033
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTNIP00000020926   Gene: ENSTNIG00000017774   Transcript: ENSTNIT00000021159
Sequence length 1003
Comment pep:novel chromosome:TETRAODON8:21_random:1500559:1507259:1 gene:ENSTNIG00000017774 transcript:ENSTNIT00000021159 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LPACRLSLQPSLLRAIFNVDPDEVRSLILKKEDVNVQDNEKRTPLHAAAYLGDWAILTPT
LRLKESRGARVNAKDNKWLTPLHRAVASCSEDAVAALLKHSADVNARDKNWQTPLHVAAS
NKAVRCAEALVPLLSNVNVSDRAGRTALHHAAFSGHVEMVKLLLSRGANINAFDKKDRRA
IHWGAYMGHLEVVKLLVASGAEVDCKDKKAYTPLHAAASSGMSSTVHYLLSLGVNVNEVN
AYGNTPLHLACYNGQDVVVGELIQAGAKVNQENERGFSPLHFASSSRQGALCQELLLTHG
AHINIQSKDRKTPLHMAAAHGRFSCSQALIQNGADIDCEDKDRNTALHVAARQGHELIIT
ALVKHGANTARWRGVYGMFPFHLAALSGFSDCCRKLLSSGTFTPVAFHHGRHRDDARFDI
DTPDDFGRTCLHAAAAGGNLECLNLLLKVGADLNRKDHFGRTPLHYASANCNYQCVFALG
GSGASVNVLDQRGCGPLHYAAAADTEVVPFIRLRCVEYLLRNGADPGANDKQGYCAVHYA
SAYGRTLCLELLMETSGRDAVSDGRTPVSPLHLVAYHGHCGALEVLLASILDVDACSPEG
RTPLSLSCSRGHQDCVALLLHHGASPMTRDYTHKKTAMHAAAMNGHQECLRLLLSHSQHL
DVDAQDINGQTPLMLAVLNGHTECVYSLLSQGASVENQDRWGRTALHRGVVTGQEDCVEA
LLQRGANVCVRDAQGRSPLHLASACGRVAVLGALLQAGSSSHTHLTDNQGYTPLHWACYN
GYDSCVEVLLDQEVFKQVKGNAFSPLHCAVINDNEGVAEMLIESMGTNIINTSDSKGRTP
LHAAAFSDHVECVSLLLSHGAEANAVDARLSRTPLMMAALNGQTNTVEVLVNSAKVDLTL
QDAHRNTALHLACSKGHETCALLILEKIRDRNLINCPNAALQTPLHVAARGGLTVVVQEL
LGKEASVLAVDENGYTPALSCTPNRDVADCLALILNSMMPTSP
Download sequence
Identical sequences H3DK80
ENSTNIP00000020926 99883.ENSTNIP00000020926 ENSTNIP00000020926

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]