SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTNIP00000020928 from Tetraodon nigroviridis 76_8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTNIP00000020928
Domain Number 1 Region: 602-723
Classification Level Classification E-value
Superfamily PX domain 2.88e-26
Family PX domain 0.0014
Further Details:      
 
Domain Number 2 Region: 419-563
Classification Level Classification E-value
Superfamily Regulator of G-protein signaling, RGS 1.77e-24
Family Regulator of G-protein signaling, RGS 0.0018
Further Details:      
 
Weak hits

Sequence:  ENSTNIP00000020928
Domain Number - Region: 165-252
Classification Level Classification E-value
Superfamily Cytochrome c oxidase subunit E 0.0772
Family Cytochrome c oxidase subunit E 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTNIP00000020928   Gene: ENSTNIG00000017776   Transcript: ENSTNIT00000021161
Sequence length 1025
Comment pep:known_by_projection chromosome:TETRAODON8:21_random:1516073:1524206:-1 gene:ENSTNIG00000017776 transcript:ENSTNIT00000021161 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
VSQAPSLRSRFIRAQRLCDPSGLHSHICTSAVGNVAERRGKPDPQGSDHKASLSIWGWGG
LGVVLFLVTFGPFAIFYLAFYIFCFVGGGFAVTLLYGKINSEKQLEQCEQSYLPPTQVGI
LKTLDEMKLEMKPIKIDRRLTGSSFIDEPLQQVIQFALRDYIQYWYYTLSEDESFLLEIR
QTLQNALVQFCTRSKEVDWQPYFTTRLVDDFATHLRVFRKAQDRLADREDKQRDVTEELV
DSFFEAEVEMERKVCRDMVCTSRKDEEGFLRDLCELLLYLLLPPGDFHNKNMRYFLREVL
ACGVLLPLINQLSDPDYINQFVIWMIRDSSCNYEAFMNILKLTDKPTELEAVKDKVAEEL
QYLRSLDTAGDDINVIKNQINSLLFVKKVCETRIQRLQSGKEVDALKLAANFGKLCVIPL
DHILVHNIALQFFMDFMQSAGAQAELFFWLTVEGYRVTAQQQLEAMQGWQKDGKKQPSAT
KALLKSAALGVYEQYLSDKASPRVQVDQESVVNLGEKLQKDDPTPEIFDEIQRNVYDLML
HDERYYPSFKQSPLYVRMLAELDMLKEPSYRGSDDGEGESFNGSPTGSISLSLDDLSNSC
HDESMHIHACISDTGVCNDHGKTYALYTITVHRRTQDGSEECWKTYRRYSDFHDFHMRIT
EQFENLASILKLPGKKTFNNMDRDFLEKRKKDLNAYLQLLLNPEMVKACPTLVPYVYDFL
ENKAYSKGKGEFARKIDTFVNPLRSSMRNMSNAVKALPDSLAEGMNKVSDNMGRMSERLG
QDIKQSILKVPPLLPKSDIDPEHCRVSAQLDDNVDDNIPLRVMLLLMDEVFDLKEKNQWL
RRNIKNLLQQLIRATYGDTINRSGADAHTHTHTHTRGCLFIFYTLYRKIVDHVDFLTSPE
QVAEYVKKFRDSYWPNGILAETPPRRDKNIRMRTRVAAKTSLLGIMPDELKHIIGADTTR
KGILRVFDMFQHQPMNRRLVYVFLEGFLETMFPQFKFPELFVKLHSRSPRILRYSQRIKC
SSLKR
Download sequence
Identical sequences H3DK82
99883.ENSTNIP00000020928 ENSTNIP00000020928 ENSTNIP00000020928

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]