SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTNIP00000020954 from Tetraodon nigroviridis 76_8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTNIP00000020954
Domain Number 1 Region: 611-727
Classification Level Classification E-value
Superfamily Cadherin-like 7.71e-31
Family Cadherin 0.0011
Further Details:      
 
Domain Number 2 Region: 281-402
Classification Level Classification E-value
Superfamily Cadherin-like 1.06e-29
Family Cadherin 0.0011
Further Details:      
 
Domain Number 3 Region: 507-615
Classification Level Classification E-value
Superfamily Cadherin-like 3.57e-28
Family Cadherin 0.0011
Further Details:      
 
Domain Number 4 Region: 718-823
Classification Level Classification E-value
Superfamily Cadherin-like 7.71e-22
Family Cadherin 0.003
Further Details:      
 
Domain Number 5 Region: 139-190,239-286
Classification Level Classification E-value
Superfamily Cadherin-like 1.18e-19
Family Cadherin 0.0056
Further Details:      
 
Domain Number 6 Region: 394-511
Classification Level Classification E-value
Superfamily Cadherin-like 3.57e-19
Family Cadherin 0.0033
Further Details:      
 
Domain Number 7 Region: 35-104
Classification Level Classification E-value
Superfamily Cadherin-like 0.000000243
Family Cadherin 0.0069
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTNIP00000020954   Gene: ENSTNIG00000017802   Transcript: ENSTNIT00000021187
Sequence length 1087
Comment pep:known_by_projection chromosome:TETRAODON8:18:716762:725584:-1 gene:ENSTNIG00000017802 transcript:ENSTNIT00000021187 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MQRLGAVHSSVAQAVGIVVLVLQLLTQLPGANSALRYRVAEEGPPDVKIGNVAADLGLTA
GTGSGDVTFALESGSEYFKIDNVTGELTTGPRRIDREKLPQCQMIFDENECFLDFEVSVI
GPLQSWVDLFEGRVVITDINDNTPSFPSPVLQLSVEENRPIGTLYLLPTATNRDFGRNGI
NRYELIQDGAAGATSTRRAEGGEPHYKSGGTRGPKRENGENGGARSTVFKLQVADIPDGE
KQPQLIVKGTLDREQKDSYELILRVRDGGNPPRSSQALLRVSITDVNDNSPQFERSTYEA
EMAENAPPGTPVLQVRASDRDVGVNGQVEYVFGAATESVRRLLRLDEATGWLSVLHRIDR
EEVAQLRFTVTARDRGQPPRTDRTTVVLAVRDENDNVPVVEIRKIGRIPVRDGAALVPEN
VLVDTPVALVQVSDRDQGENGAVTCTVVGDVPFTLKPAEDAFDRNKKKYFLHTSALLDYE
TTKEYSVTIVAVDSGSPSLSSNSSLMVRVVDINDHPPIFAQSVVEVHFAENNSPGERVVT
VVATDADSGKNAEIAFSLDPAGNGPFYIDADNGDIRATGVLDREQRERYELRVIAKDKGT
PSLQGSATVVIQVTDRNDNAPKFAQEIFTFYVKENLLANSPVGMVTVTDADEGENAELSL
FVEEEMFSIENNTGTIFSSASFDREKLSIYTFRVRAVDGGEPRKTATATVSLFVTDENDN
APSITSPANESYTLLPPASSARTVVRTVKAVDSDSGLNADLRYALVGGNPYRLFEIGHTN
GVITLAEPLERRHRGLHRLVVRVTDSGIPSLCATALVHIFINDSLANASLVEAQIARSLA
APLSLDIAGDPDSDRSLGKQRLSVAIGVLAGAAAVILVILLVVTARQCGAQGKNGYEAGK
KEPEEDFFSPSGAQPQVSRGRGSDRGRKPRRDKRTGSSGGVSAGGGKSDRSLYSGIVTVN
GLRRHANDDEEEELSSASDRLAARYCVVDDDPGSPRMGSGRRHQSSPDLARHYKSSSPLP
AVNLQPHSPPAEGKKHQAVQDLPPSNTFVGNGDAMSVGSDQCSEYGCHTGNKYNKQVGVP
QKAPKMQ
Download sequence
Identical sequences H3DKA8
ENSTNIP00000020954 99883.ENSTNIP00000020954 ENSTNIP00000020954

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]