SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTNIP00000020962 from Tetraodon nigroviridis 76_8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTNIP00000020962
Domain Number 1 Region: 419-807
Classification Level Classification E-value
Superfamily Ankyrin repeat 2.75e-126
Family Ankyrin repeat 0.000000000436
Further Details:      
 
Domain Number 2 Region: 180-437
Classification Level Classification E-value
Superfamily Ankyrin repeat 3.18e-75
Family Ankyrin repeat 0.00000316
Further Details:      
 
Domain Number 3 Region: 30-245
Classification Level Classification E-value
Superfamily Ankyrin repeat 6.73e-57
Family Ankyrin repeat 0.0000194
Further Details:      
 
Domain Number 4 Region: 1462-1541
Classification Level Classification E-value
Superfamily DEATH domain 9.42e-24
Family DEATH domain, DD 0.0055
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTNIP00000020962   Gene: ENSTNIG00000017807   Transcript: ENSTNIT00000021195
Sequence length 1541
Comment pep:known_by_projection chromosome:TETRAODON8:18:622560:645150:-1 gene:ENSTNIG00000017807 transcript:ENSTNIT00000021195 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
RAREKRRQQRERAERKRQSSHLQSDSNTSFLRAARAGNIDKVLDFLKNGIDISTCNQNGL
NALHLAAKEGHKDLVEELLDRGAPVDSSTKKGNSALHIASLAGQKEVVRLLVKRGANINS
QSQNGFTPLYMAAQENHLEVVRYLLENDGNQSIATEDGFTPLAIALQQGHNSVVSLLLEH
DTKGKVRLPALHIAARKDDTKSAALLLQNDHNADVQSKSGFTPLHIAAHYGNVNVSTLLL
NRGAAVDFTARNGITPLHVASKRGNTNMVALLLDRGAQIDAKTRDGLTPLHCAARSGHDQ
AVEILLDRGAPILARTKNGLSPLHMSAQGDHIECVKLLLQHQAPVDDVTLDYLTALHVAA
HCGHYRVTKLLLDKKANPNVRALNGFTPLHIACKKNRVKVMELLVKYGASIQAITESGLT
PIHVAAFMGHLSIVLLLLQNGASPDIRNIRGETALHMAARAGQMEVVRCLLRNGALVDAM
AREDQTPLHIASRLGKTDIVQLLLQHMAHPDAATTNGYTPLHISAREGQLETAAVLLEAG
ASHSLPTKKGFTPLHVAAKYGNLDVAKLLLQSKALPDDAGKNGLTSLHVAAHYDNQDVAL
LLLDKGASPHSTAKNGYTPLHIAAKKNQTKIASALLQYGAETNILTKQGVSPLHLAAQEG
HTEMTGLLLDKGAHVNAATKSGLTPLHLTAQEDKVGAAEVLAKYDANLDQQTKLGYTPLI
VACHYGNAKMVNFLLQQGASVNAKTKNGYTPLHQAAQQGNTHIINVLLQHGAKPNTTTMS
GNTALSIARRLGYISVVDTLKVVTEEVITTTTTVTEKHKLNVPETMTEVLDVSDEEEDLL
TCDYLNRAANLIERGEDTMTGDGGEYLRAEDLRDLGDDSLPGHYLDFRQVEIGQTDKQMR
RFGTSQHTPIHQSFTQREGFFIEDMLTSHQVSVLSKEHEKDSFRLSWGAEHLDNVVLSSS
LLHSGFLVSFMVDARGGAMRGCRHNGLRIIVPPRKCSAPTRVTCRLVKRHRLASMPPMVE
GEGLAGRIIEVGPTGAQFLGPVIVEIPHFAALRGTERELVILRSETGESWREHHCDFTEE
ELNQILNGMDEKLDSPEELEKKRICRIITRDFPQYFAVVSRIKQDSHLIGPEGGVLSSTL
VPQVQAVFPEGALTKKIRVGLQAQPIDGDVVKKILGNKAAFSAIVTLEPRRRKFHKPITM
TIPIPKSPNTEGPTSEFSGETPTLRLLCSITGGTTPAQWEDITGSTPLTFVNHCVSFTTN
VSARFWLIDCRQVQESVSFASQLYREIICVPYMAKFVIFAKTLDPIEARLRCFCMTDDKM
DKTLEQQENFTEVARSRDVEVLEGKPIFVDCFGNLVPLTKSGQHHVFSFFAFKENRLALF
IKIRDTAQEPCGRLSFTKEARTYRSLTHNAICNLNITLPAYSKSEKSEKKFKLGLFLIKS
KHASITEPQLQSGQDPLKSKEETLTIIADLLGFSWTELAKELEFSENDIQSVRTDNPNSL
QEQSHALLQRWVEREGKHATEDCLIKTLTKINRMDIVHLIE
Download sequence
Identical sequences H3DKB6
ENSTNIP00000020962

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]