SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTNIP00000021045 from Tetraodon nigroviridis 76_8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTNIP00000021045
Domain Number 1 Region: 194-318
Classification Level Classification E-value
Superfamily Dystroglycan, domain 2 1.09e-59
Family Dystroglycan, domain 2 0.00000266
Further Details:      
 
Domain Number 2 Region: 481-582
Classification Level Classification E-value
Superfamily Cadherin-like 3.61e-16
Family Dystroglycan, N-terminal domain 0.02
Further Details:      
 
Domain Number 3 Region: 76-169
Classification Level Classification E-value
Superfamily Cadherin-like 0.0000000000847
Family Dystroglycan, N-terminal domain 0.00044
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTNIP00000021045   Gene: ENSTNIG00000017886   Transcript: ENSTNIT00000021278
Sequence length 876
Comment pep:known_by_projection chromosome:TETRAODON8:9:6158204:6161680:-1 gene:ENSTNIG00000017886 transcript:ENSTNIT00000021278 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
PQARCYALHTQRRELGGRWEQRTIPLLVGLLLAVVPGAASEQDGETVVEMISVELEASMQ
SSVLSELQAAASLAVHGDIPDSSAVVGQAFQLRIPSGPANGSCNIDLTEMGKETLPSWLY
WDQESCTLRGLALEQDKGVYHITASGEKTAEKMGNRVLPSAAFSVEVYSEDRADTEPALL
MLHADGGGGAQPLTCSPEAPVTVLTVILDADLTKMGAEQRVALLSSMRTFSHMPLEHMRL
VPVINNRLFDMSAFMAGPGNAKKVVENGALLSWRLGCALDQGSVPDISSVQFSAKDGIMS
SRLGYPVVGWHIVNKKVHGVKRVRRQLYNTPTHVPSLLPPTTHPEPPVRVIPTPTSPLIA
PATDNSAPPVRGPLPLPVKPTLRVRDQIAHTPVSGPPQPTRVLGTTSTIPIQPTMTRPTI
VEATAQPTPPGTTKKPRPSATRKPKKPKSSTPAPREPKSTTPKPPKRTTTVSLATDVNQN
PQIRNAIDQVNAWVGTYFEVKIPPDTFFDKEDGTTDKLRLTLKKTPKEPVSETSWIQFNS
TIQLLYGLPEEQHEGKHEYFMLATDKGGRSIMDAFEVQVNRWSNSDKPSAVFTARFHGDA
KSLSDDVQKKILLTKKLAYAIGDRNSSTVTLRNITSGSIVVEWTNNSLVQNPCPKDQIAA
LSNKISDPKGTPKVAFVKAMEPEFKPISISVRGTNKCQRYTFVPPGELPATVLPTATPSP
GTGRRSSDDVYLHTVIPAIVVAALLLIAGIIAMVCYRKKRRGKMTMEEQATFIKKGVPII
FADELDDSKSPPSSSIPLILQEEKPPLPPPEYPNMAGPHSTLLNQDRLEEYSIYHDDDPN
APPYQPPPPFTVPIESKGSRPKNMTSYRSPPPYVPP
Download sequence
Identical sequences H3DKJ9
ENSTNIP00000021045 ENSTNIP00000021045 99883.ENSTNIP00000021045

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]