SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTNIP00000021054 from Tetraodon nigroviridis 76_8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTNIP00000021054
Domain Number 1 Region: 103-202
Classification Level Classification E-value
Superfamily POZ domain 1.92e-26
Family BTB/POZ domain 0.0078
Further Details:      
 
Domain Number 2 Region: 265-377
Classification Level Classification E-value
Superfamily POZ domain 1.98e-24
Family BTB/POZ domain 0.0083
Further Details:      
 
Domain Number 3 Region: 6-72,105-124
Classification Level Classification E-value
Superfamily Ankyrin repeat 0.000000000000363
Family Ankyrin repeat 0.0046
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTNIP00000021054   Gene: ENSTNIG00000017894   Transcript: ENSTNIT00000021287
Sequence length 481
Comment pep:known_by_projection chromosome:TETRAODON8:9:6290142:6293723:-1 gene:ENSTNIG00000017894 transcript:ENSTNIT00000021287 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDVYDLFSSCKKGDICRVRHLIEQRDVDLNVRDKWNSTPLYYACLCGHEELVEYLLASGA
KSEANTFDGERCMYGSLNDSIRRLLKEYKCVSVSAMKRGDVAYFLHMLWEQGQYSDVKFL
VHGQIFAAHRCVLSARSEYFSDMFERKWKGKNLITLKHPLVNPAAFRALLQYIYTGQMEI
DVNLVEDSRRLAKQCKMKDLIEELDNKCKQVYEFANDATVSNKPGVCVKVLSLKPRHCQL
EEELAQLAHAALPAELAVGFGELPFNRMDWFPTYPDICFRVDGYNFLCHKAFFCGRSDYF
RALLEDHFSEGEQLQSHPSTLVITLHNISHEIFIHVMYYIYTDKTELMAESVFDVLCVAD
MYLLPGLKRLCGKTLAQTLCKDNVVYMWKTAKLFQLSRLEDQCVEYMAKMIYQLVEQPEL
AEVIKEDAASVEDRQATDSVPLVDEIRYHIASNVQTYSEIEEANQKLEALEELLFSINIC
C
Download sequence
Identical sequences H3DKK8
ENSTNIP00000021054 99883.ENSTNIP00000021054 ENSTNIP00000021054

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]