SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTNIP00000021075 from Tetraodon nigroviridis 76_8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTNIP00000021075
Domain Number 1 Region: 135-319
Classification Level Classification E-value
Superfamily DNA-glycosylase 2.67e-46
Family DNA repair glycosylase, 2 C-terminal domains 0.00000258
Further Details:      
 
Domain Number 2 Region: 11-134
Classification Level Classification E-value
Superfamily TATA-box binding protein-like 9.26e-42
Family DNA repair glycosylase, N-terminal domain 0.0000157
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTNIP00000021075   Gene: ENSTNIG00000017914   Transcript: ENSTNIT00000021308
Sequence length 322
Comment pep:known_by_projection chromosome:TETRAODON8:9:6529935:6531677:1 gene:ENSTNIG00000017914 transcript:ENSTNIT00000021308 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
NTVRVWSIMAKHAVLSSGSKVWRSLPCTKSELRLDLTLECGQSFRWRETAEGHWTGVMKG
RVWTLTQTEDTLWFHVYENQERQSKTQDREEKEMLRDYFQLDVNLGDLYKKWGDADPHFR
SIANVFTGVRMLRQDPTECLFSFICTSNNHISRIQGMVERLCQALGTPLCKLDQTTYYSY
PSLSALSGSSVEARLRDLGFGYRARFLQQSAKQIQDAHGMQWLDGLRTVPYVQAREALRT
LPGVGTKVADCVCLMSLDKAEAVPVDTHVWQIAKRDYNCAFGNHQKSLTDKLHRDIGDFF
RALWGSYAGWAQSVLFCSDLKK
Download sequence
Identical sequences H3DKM8
ENSTNIP00000021075 99883.ENSTNIP00000021075 ENSTNIP00000021075

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]