SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTNIP00000021085 from Tetraodon nigroviridis 76_8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTNIP00000021085
Domain Number 1 Region: 50-534
Classification Level Classification E-value
Superfamily Sema domain 1.57e-102
Family Sema domain 0.001
Further Details:      
 
Domain Number 2 Region: 1415-1539,1705-1889
Classification Level Classification E-value
Superfamily GTPase activation domain, GAP 8.63e-34
Family p120GAP domain-like 0.026
Further Details:      
 
Domain Number 3 Region: 886-977
Classification Level Classification E-value
Superfamily E set domains 0.0000000000000204
Family Other IPT/TIG domains 0.017
Further Details:      
 
Domain Number 4 Region: 983-1057
Classification Level Classification E-value
Superfamily E set domains 0.00000000000649
Family Other IPT/TIG domains 0.032
Further Details:      
 
Domain Number 5 Region: 1069-1148
Classification Level Classification E-value
Superfamily E set domains 0.0000000000293
Family E-set domains of sugar-utilizing enzymes 0.033
Further Details:      
 
Domain Number 6 Region: 536-589
Classification Level Classification E-value
Superfamily Plexin repeat 0.00000000101
Family Plexin repeat 0.0024
Further Details:      
 
Weak hits

Sequence:  ENSTNIP00000021085
Domain Number - Region: 850-882
Classification Level Classification E-value
Superfamily Plexin repeat 0.0419
Family Plexin repeat 0.0049
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTNIP00000021085   Gene: ENSTNIG00000017924   Transcript: ENSTNIT00000021318
Sequence length 1930
Comment pep:known_by_projection chromosome:TETRAODON8:9:6621142:6673486:1 gene:ENSTNIG00000017924 transcript:ENSTNIT00000021318 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
APRWAEGQRRQPEKPRGSRPEGRMPPSILALLILGVLALEARRSASAPHIQQAFASPNHT
NNFAVDPGSGKVYLATVNTLYQLNGTLSVEVEKRTGPVEDNLLCHAPQLPQAPCEHTKSL
TDNYNKLLELDREQGVVVVCGSVYQGFCELRKMENISQIAVEFPPQGEKTVFPSMLNIAA
NHPNASTVGLVFRSGGNSRLLVGATYTGAGTQFFPKNHSKEDLRFENTPEIAIRSLNLRD
LSRLFTYDINPSEDNVFKIKQEVKSKNKLNFVHAFTQKTYSYIAFNNDAKMGHKESQPNS
ILARICLDTENPRKPSGPESRKLTESYIQMPLQCGFNGNIYNRLLSVYPASVPSEDGRDP
EPHLFGVFSKGDRKSALCAFRFGDIEEEIRQGRRNSSISPGSDVQVLDSVIQGSGAACVQ
KGKLVLQLEQLDCGAAHLQHPLALRRPLRALPLVEYPALTSVSVDCVHNHAVVFLGTSNG
RLRKLTFLANMTLVNQWTLKLPAGEAVHHHMTFDPKDSSYLYLMTSHHMLRVKVAQCDQW
RSCSDCVGAGDAHCGWCTLENRCSIQKECALGLLTRSWISMAEGPQQCPSMTLTPPEISV
SADIKDVGILINGSVPDLLGSRVECEYRPGVSTSATVHLDSGPAQIQTCPLLPRENYQSI
PPGSDHQAVSVAIKVNGTSVVSGSFILYDCERTGAIHPKTSCVSCLSARWKCYWDQENHL
CVSNKLVCHVLSPHPSSPQSAASCPSLLASDVPPAPSGTAQDFTLSLSIIFAQQGEELEC
DFGTEQRYEVTWVNSSVVKCSGITLSTNHKSQIFHLNLRRKRFYSGRGEDIFVDSPQPVK
VEVYNCKVGSSDCSQCWGREDQGHLCGWCENGCKPRDDCQPIMEQCPSPEIHKIFPLRGP
VEGGTLLTVQGRNLGRRAEAVKVSIGDVPCSLQPDRYTVSLELVCITGPSADDKTDIVQV
DVDQSGTGTSKESFSYLLPKLLYMEPNKGYRAGGTKVTITGEHLDIGSQVRVMVNNTHKC
VITEKTDNVIECTMPAITQAHADSVSVCVEFENLTCQGPDLATTYTYKKNPTIFFIKPTK
SYLSGGRTITVTGQGFDLVQSATMQVEGIGRTTCGVISNNTIHCPSHPSSESQQTAVQFF
LNGVLYTDEGPLSPDSGEEEEEEEEDSNKGHFTLEYVEDPQFFTANKEKLIKHHPGEPLT
LIINKGPSDLDLVPEEYSVMIGSYPCNISFHNDQLFHCTINGLLGSSERELPVIVQVGNF
RHTIAKVQLGGSELAIVVSIVVCCVLLLLCTVALVVYCTKSRRAERYWQKTLLQMEEMES
QIREEIRKGFAELQTDMTDLTKELNRSQGIPFLEYKQFVTRTFFPKMCSDYERSLVQHAY
ENDGIAPRVLPETHPLLQDWQATNATRPNVEEGITLFSTLLNNKHFLVTFVHALEQQKDF
AVRDRCSLASLLTIALHGKLEYYTSIMKDLLVDLIDASASKNPKLMLRRTESVVEKMLTN
WMSICMYSYLKETVGEPFFLLLCAIKQQINKGSIDAITGKARYTLNEEWLLRENVEARPQ
NINVSFQGCGMDSLSVRVMHTDTICQVKEKIIEAFYKNLPFSQWPRAEDVDLEWLDSGGN
SKLLQDLDNSSVMEDGRKKLNTVFHYQVPEGASLAMSLKDKKENTLGRVKDLDTEKYVHL
VLPHDELMETRKSHRHSHRKKVLPEIYLTRLLSTKGTLQKFLDDLFQAILSIPLDRPPLA
VKYFFDFLEEQADKRGITDPDTLHIWKTNSLPLRFWVNILKNPQFVFDIDKTDHMDACLS
VIAQAFIDACSISDLQLGKDSPTNKLLYAKEIPEYKKRVQLYYQQIQEMAPLSEQEMNAH
LAEESRKYRNEFNTNLALTEIYKYAKRYRNQQVVSALESNPTARRTQLHHKFEQVIALVE
DNIYECCSEA
Download sequence
Identical sequences H3DKN8
99883.ENSTNIP00000021085 ENSTNIP00000021085 ENSTNIP00000021085

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]