SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTNIP00000021089 from Tetraodon nigroviridis 76_8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTNIP00000021089
Domain Number 1 Region: 168-296,324-339
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.00000000000186
Family Growth factor receptor domain 0.0039
Further Details:      
 
Domain Number 2 Region: 298-335
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000351
Family EGF-type module 0.017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTNIP00000021089   Gene: ENSTNIG00000017928   Transcript: ENSTNIT00000021322
Sequence length 417
Comment pep:known_by_projection chromosome:TETRAODON8:9:6699562:6701793:-1 gene:ENSTNIG00000017928 transcript:ENSTNIT00000021322 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LRPFCPRGTMWWTWTWFLPALVLLSELSVVRVQTSPCQTCRKLAESFIKGLDKTANKNFG
GGNTAWEEEKLAKYARSETRLLEIVEAACEKTDFECNQLLEQIEDQVETWWFHRQQEAPN
LFEWLCIEELRLCCPPGHFGSECKECPSGPGGVCGGLGRCEGEGTRLGDGECVCDPGYSG
HLCQNCADGYFREKRSNDSVGACAACFYSCRKCSGPEDYKCLDCKPGWVLHDNKCVVDID
ECGTELARCPSNTYCHNTDGSYECRGCDQACVGCMGSGPARCKKCARGYRYKGAKCLDID
ECSERAIACPGLNEACINEEGSFHCDCADGFIRRDSICVENKPSAGPEKGLFDDITDEEV
LVLQQMFFGVVICALATLAAKGDMVFTAIFIGGVAAMAGYWLTEKGDYMLDGFLKGR
Download sequence
Identical sequences H3DKP2
ENSTNIP00000021089 ENSTNIP00000021089 99883.ENSTNIP00000021089

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]