SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTNIP00000021097 from Tetraodon nigroviridis 76_8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTNIP00000021097
Domain Number 1 Region: 848-981
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.0000000000000502
Family Growth factor receptor domain 0.011
Further Details:      
 
Domain Number 2 Region: 741-887
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.000000000000596
Family Growth factor receptor domain 0.019
Further Details:      
 
Domain Number 3 Region: 628-745
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.000000000204
Family Growth factor receptor domain 0.013
Further Details:      
 
Domain Number 4 Region: 551-593
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000286
Family EGF-type module 0.0088
Further Details:      
 
Domain Number 5 Region: 384-491,550-593
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.00000518
Family Growth factor receptor domain 0.0078
Further Details:      
 
Weak hits

Sequence:  ENSTNIP00000021097
Domain Number - Region: 968-1011
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000648
Family EGF-type module 0.025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTNIP00000021097   Gene: ENSTNIG00000017936   Transcript: ENSTNIT00000021330
Sequence length 1129
Comment pep:known_by_projection chromosome:TETRAODON8:9:6898588:6912662:-1 gene:ENSTNIG00000017936 transcript:ENSTNIT00000021330 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
QRDCTGVDCPPVDNCLQTTLEVGACCPTCTQRGCTCEGYQYYDCIHAGFQKGKVPEGESY
FVDFGSTECSCPQGGGKISCHFIPCPELPSNCIDILQPEDGCLQCERIGCTHGNKKYEAG
HSFQMDQCHVCHCPNEGGKLMCSLIPGCDLRGSNKPVRVGVTTTEDNSRFREINSRPDTS
QVSPMEPHSKLALGNTLPLYKQDPPGFGTVKYDDTLAGPTSSSVQKLAQPLESTTVPAAF
PEPNSTSSSSHDEQRHELREPQETREAAVTQDIGPTTTEAQSKPTTVLTTTQEVTTEDLR
PQQEAGKSPLEHHLQSPGVLQVPLKDVFHTAHPREQKPSQGPPSRSHASFHSEVEDEVDP
VSVHGLIGPPLNGVSAKELVQTCCETGEKWASSNGHCNDMEPPTKDMHSICWTAQRQCCV
GSLGETQCLAGINAARGGEACPKKVSNNCETDSYKECCDCCFLGLQLRSEGRRCEPHRYL
GFHCRHVFLTCCEGEEGSHEERYSAVRERPTFTSSPPLQKISDSPYPREAFFIGEEQDGG
NAVEDPIEGEDTNECLIYEGNICHHRCINTPGSFRCECFPGYVLQEDAFTCVPEAVEEDN
RLKETEGPAVKPTSPLPPPTEPPAPADPCQGNSPCQQQCTSVGGRPHCSCFPGFSLMTDG
VSCMDVNECLSGRVCKLNQLCVNTVGSYVCQRLIICPPGYQISNDICEDINECVQQSHNC
GQDQECVNTEGSFRCNSKPRCPLGFNRESAGTDTDECGASSQTCSPAFNCINTVGSFVCQ
RKLVCSRGYHSSPDGSKCVDVDECQSGAHRCGGGQLCHNLPGSYRCECQTGYEYNSFRRM
CVGTSDRCWRYSGRVCAQTCENTPGSYECSCTSGFRLSSDGKNCESPDVNECLASPCSQE
CANIYGSYQCYCRQGYFLRQDGHTCDDIDECSQSIGHLCTYKCVNVPGSYQCACPEYGYT
MSANGRSCRDVDECTTGAHNCSVAETCYNIQGGYRCLSLSCPPNYRKVSDTRCERINCPN
YLECQNSPLRITYYYLSFQSNIVVPAQIFRIGPSPAYSGDNVIISITQGNEDSYFSTRKL
NAYTGAVYLQRQVEGPRDFLINVEMKLWRQGTFTTFHARIYVFITGNSV
Download sequence
Identical sequences H3DKQ0
ENSTNIP00000021097

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]