SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTNIP00000021111 from Tetraodon nigroviridis 76_8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTNIP00000021111
Domain Number 1 Region: 117-327
Classification Level Classification E-value
Superfamily Ankyrin repeat 4.04e-39
Family Ankyrin repeat 0.0006
Further Details:      
 
Domain Number 2 Region: 1681-1747
Classification Level Classification E-value
Superfamily SAM/Pointed domain 3.29e-16
Family SAM (sterile alpha motif) domain 0.00014
Further Details:      
 
Domain Number 3 Region: 578-670
Classification Level Classification E-value
Superfamily PDZ domain-like 0.000000000000373
Family PDZ domain 0.0000557
Further Details:      
 
Domain Number 4 Region: 460-528
Classification Level Classification E-value
Superfamily SH3-domain 0.000000000133
Family SH3-domain 0.0028
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTNIP00000021111   Gene: ENSTNIG00000017950   Transcript: ENSTNIT00000021344
Sequence length 1749
Comment pep:known_by_projection chromosome:TETRAODON8:13:4428161:4502631:-1 gene:ENSTNIG00000017950 transcript:ENSTNIT00000021344 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEEPTGNTVVIRIGIPDLQQTKCLKFNVDAPIWRSKQRILCTLNQSLKDVLNYGLFQPAY
NGKAGKFLDEERQLREYPFPSLAPVPYLEFRYKRRIYTQTYLDEKQLSKLHTKANLKKFM
EHVQQRNIEKVSRFLDKGLDPNFHDPDTGECPLTLAAQLEGCAELIKVLKNGGAHLDFRT
KDGITALHKAVRSKNHTALIPLKAAKHQFDFSSEKICTPLLXCCELLLHDHAQVGCVDEN
GWQEIHQACRYGHVQHLEHLLFYGADMSAQNASGNTALHVCALYNQESCARVLLFRGANK
EIKNYNSQTAFQVAIIAGNFDLAEIIKVHKSSDVVPFRETPSYTNRRRAPGPLPSPRSLL
RSASDNNLNGDHDHIHSQAPRETRGRRGHSPVPSLRSLPAYLNIQQSEAERHNRQIGTLI
VSLSKPSKGRGATKDRGKKDKGCPGSMQRDPSPPHHTPQPLAGSRGPKRKLYSAVPGRTF
IVVKPYTPQGEGEIQLNRGERVKXMNIKRRWFWEGTVKGRTGWWPITQTCQPEVKSKKQE
TRPKTREDRTKRLFRHYTVGSYDNFTSYRDHTVKNTDRRIIMRKHNIQRFSFEMKEFLPE
TPIEEFTPTPAFPALQYLESVDVEGVAWRAGLRTGDFLIEVNGVNVIKLGHKQVVSLIRQ
GGNRLLMKVVTVTRKPETEEVIRRKAPPPPKRAPSTTLTLRSKSMTAELEELASARRRRG
ERLDEMLASQESVLRSQPTEADYRAATVKQRPTSRRITPAEISSLFERQGMTLHGVLHPG
IERGHIQMTKGATEEDRLSALADEHRFPRSSSMTDSLRDHSQAHPIPPPPEMDTQQSRHD
HDTGSPPVFCSPPPPSRTQSQGHEPGIRSSFKPSSLDLSYEAAQRQASHIERHKKARSMI
ILQDSSHLPVEPTEIPRPSAATPPERIKRKGRVIDNPYANVGQFSIGLYTPTKPQRKKSP
LVKQLQVEDAQEKASLALAAAHSRESSPSGRHPHAHGHTHTSRGKGPFAAAIAGAVKDRE
RRLEERRKSTVFLSVGTMEGASTTSSDLPSLTQSHSVDERMLTRELGQLPPPASALSPSP
SGTTFIHPLTGKPLDPSSPLALALAARERALTSQNQSPTSSPEPRTKPERISQSGIFIDL
QTKESQQGEGVTTTPPFSPKSPKAMGQEMEVKAEERKEDKRLDDKKSMLISIVDTSQQKT
AGLIMVHATSNGQADGLGTELEQARTSKSIEPSRSPSPRAKSPSLAVSQPQAATPNPQPS
GPAQEKSLAQGSSEEDVDQYTVTLPPAMLSSSDEETREELRKIGVVPPPDAFANGLLALK
PQPQPQPQPPPPPPPPSAAAVSGKPSDPLEPPPVGESGSAADSGVEEADTRSSSERERDH
HLETTSTVSTVSSMSTLSSECGEPADTHTTHTSYADGQTFVLDKPPVPPKPRLKSQIGGK
GSVTFRDPLLKQSSDSELLSQQQAAALAAAAGGAGLPPGGSASVTGLAPTKPRYLFQRRS
KLWGDPVEPRGPGDDDAKPSVMGELSSRLQQLNKDTRSLGEEPLGASLDPGRKSPVAGAR
LFSSLGELHTISQRSYGTTFTIRPGSRYPVTRRAPSPGPGSPDRGDPLGRFTSFGLPTSP
TTPPQTILKSSSLSLPQEPKEVRFVMRSSSARSRSRSPSPSPSHSPRLGSPLLTLRPFHQ
KPLHLWNKYDVGDWLESINLGEHRAGFQEHEIEGSHLPALTKDDFAELGVTRVGHRMNIE
RALKQLLES
Download sequence
Identical sequences H3DKR4
ENSTNIP00000021111 ENSTNIP00000021111 99883.ENSTNIP00000021111

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]